KEGG   Haemophilus parainfluenzae: PARA_09800Help
Entry
PARA_09800        CDS       T01605                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PARA_09800
   01230 Biosynthesis of amino acids
    PARA_09800
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PARA_09800
   00030 Pentose phosphate pathway
    PARA_09800
   00051 Fructose and mannose metabolism
    PARA_09800
   00052 Galactose metabolism
    PARA_09800
  Energy metabolism
   00680 Methane metabolism
    PARA_09800
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PARA_09800
Enzymes [BR:hpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PARA_09800
Protein phosphatases and associated proteins [BR:hpr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PARA_09800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
980790..981755
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRAALAEGLEVFGIYDGYQGLYNNKIQQLNRYNVSD
IINRGGTFLGSARFPEFKDPAVREKCAEILRSHGIDALVVIGGDGSYMGAKLLTEEHGFP
CVGIPGTIDNDVAGTDYTIGYETALQTAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
SAGIAGGCEYIVASEMEFNREELIRQIERSIIRGKRHAIIAITELITDVHSLAREIEARV
GHETRATVLGHIQRGGSPCAFDRILGSRMGVYAVDILLQGKGGYCVGIQNEKLVHHDIID
AINNMRREFKADWLEMAKRLE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgctgtattaaccagtggtggtgatgcaccaggtatgaatgctgcc
atccgtggcgttgttcgtgcagctcttgcagaagggcttgaagtatttgggatttatgac
ggttatcaaggcttatataataataaaatccaacagttaaaccgttataatgtatcagat
attattaaccgtggtgggacattcttaggttctgctcgtttccctgaatttaaggatcct
gccgtacgtgagaaatgtgcagaaattttacgttcacatggtattgatgccttagttgtt
attggtggtgacggttcttacatgggggctaaattgcttactgaagaacatggtttccct
tgcgtaggtatccctggcacaattgataacgatgtggctggaacagattacacaatcggt
tatgaaaccgcactacaaacagcggtggatgccattgaccgtttacgtgacacttcaagt
tctcaccaacgtatttctatcgtggaaatcatgggtcgtcactgtagtgacttaaccatt
tctgcaggtattgctggtggttgtgaatacattgtggcatctgaaatggaatttaaccgc
gaagaattaattcgccaaattgagcgcagtattattcgtggaaaacgccacgccatcatt
gcgattactgagttaatcactgacgtgcattctcttgctcgtgaaattgaagctcgtgta
ggtcatgaaacccgtgcaaccgtattaggccatattcaacgtggtggttcgccttgtgcc
ttcgaccgtattttaggctcacgtatgggcgtatatgcggtagatatattgctacagggt
aaaggtggctactgtgtgggtattcaaaacgaaaaattagttcaccacgatattattgat
gcaatcaacaatatgcgtcgtgaatttaaagcagattggttagaaatggctaaacgctta
gaataa

DBGET integrated database retrieval system