KEGG   Haemophilus parainfluenzae: PARA_10120Help
Entry
PARA_10120        CDS       T01605                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hpr  Haemophilus parainfluenzae
Pathway
hpr00900  Terpenoid backbone biosynthesis
hpr01100  Metabolic pathways
hpr01110  Biosynthesis of secondary metabolites
hpr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PARA_10120
Enzymes [BR:hpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PARA_10120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: CBW15118
UniProt: E1W426
Position
1015854..1017053
Genome map
AA seq 399 aa AA seqDB search
MQKQNLVILGSTGSIGHSTLSVIEHNPDKYHAFALVGGKNVETMFEQCVKFQPHFAALDD
ENAAKVLREKLASHYIKTEVLAGQKAICELAAHPDADQVMAAIVGAAGLLPTLSAVKASK
KVLLANKESLVTCGQIFIDAVKQSKAKLLPVDSEHNAIFQSLPPEAQEKIGFCPLKELGV
SKIVLTGSGGPFRYTSLSEFEHITPEQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWL
FNASADEMEVIIHPQSIIHSMVRYVDGSVIAQMGNPDMRTPIAETMAYPSRTVSGVEPLD
FFKIKELTFIEPDFNRYPNLKLAIDAFAEGQYATTAMNAANEIAVQAFLDGYIKFTDIAK
INQASVEQMPSSIISSIDDVLAVDQLARELADSLIKKLM
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacaaaatcttgttattttaggatcaaccggttctattggtcatagcaccctt
tctgttatcgaacataatcctgacaaataccatgcctttgcgttagtagggggcaaaaat
gttgagacgatgtttgaacaatgcgtgaaatttcaaccgcactttgctgcattagatgac
gaaaatgcagcaaaggtattgcgagaaaaattagcttcacactacattaaaacggaagtc
ttagccggacagaaagccatttgtgagttggcagcgcatccagatgctgatcaagttatg
gcagccattgttggggcagcgggattattgccgactctttcagcagtaaaagcgagtaag
aaagtcttgcttgcgaataaagaatccttggtgacgtgtggccagatctttattgatgca
gtgaagcagtcaaaagcaaaattattgcctgttgatagtgagcataacgcgatttttcaa
tccttaccgcctgaggcacaagaaaagattggattttgtcctttgaaagaattaggggtc
agtaaaattgtcttaacgggttctggtgggcctttccgttatacgtcgttaagcgagttt
gagcatattacgccagaacaggccgttgcacatccaaactggtcaatgggcaaaaaaatt
tccgtggattctgccacgatgatgaataaaggtttagaatacattgaggcacgctggcta
tttaatgcatcggcagatgaaatggaagtgattattcatcctcaatctattattcattca
atggtgcgttatgtagatggctcagtcattgctcaaatgggcaatcccgatatgcgcacg
cccattgcggaaaccatggcttatccaagtcgtacagtcagtggtgtggaaccattagat
ttctttaaaatcaaagaattgacatttatagaacctgattttaatcgttatccaaattta
aaattagcgattgatgcgtttgcagaagggcagtatgcgacaactgcaatgaatgcagca
aatgaaattgcagtacaagcctttttagatggatatattaaatttacagatattgcgaaa
attaaccaagcatcggttgagcaaatgccatcttctatcatttcaagcattgatgatgta
ttagccgtagatcagctagcacgtgagctagccgattcgctgattaaaaagttaatgtag

DBGET integrated database retrieval system