KEGG   Haemophilus parainfluenzae: PARA_10330Help
Entry
PARA_10330        CDS       T01605                                 

Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PARA_10330
   00052 Galactose metabolism
    PARA_10330
   00500 Starch and sucrose metabolism
    PARA_10330
   00520 Amino sugar and nucleotide sugar metabolism
    PARA_10330
Enzymes [BR:hpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PARA_10330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1039991..1040878
Genome map
AA seq 295 aa AA seqDB search
MKVIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVRSICPKDVTIMHVRQGNAKGLGHAVLCGRPVVGN
EPFAVVLPDVLLADFTANQKKENLSAMIKRFKETQASQIMVAPVAADEVSSYGIADCGGV
ELKGGDSVKINSIVEKPSVEEAPSNLAVVGRYVFSAAIWDLLEKTPVGVGDEIQLTDAID
MLIEKETVEAFHMTGRSFDCGDKIGYMEAFVEYSLRHDKLGKEFKAFLKDLAKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcattattcccgtagcaggtttaggtactcgaatgttacccgcaacgaaagcg
attccaaaagaaatgttaacgcttgtggataaaccacttattcaatatgttgtgaatgag
tgtgttgctgcaggcattaaagaaatcgtcttagtcacacattcttctaaaaatgcgatt
gaaaaccactttgatacgtcttttgaattggaaacaatgcttgagaaacgtgttaaacgt
caacttttggaagaggttcgttctatttgtcctaaagatgtaactatcatgcatgttcgt
caggggaatgcgaaaggcttgggccatgcggtgttatgtggtcgtcctgtcgttggaaac
gagccgtttgcagtggtgttacctgatgtgcttttagcggattttacggcaaatcaaaag
aaagaaaatctttcagcaatgattaaacgttttaaagaaacacaagcaagccaaatcatg
gtagcgcctgttgctgccgatgaagtgagtagctatggtatcgcggattgtggtggagta
gaattaaaaggtggtgatagcgttaaaattaacagcattgttgaaaaaccatctgttgaa
gaggcaccatcaaatcttgctgttgttggacgttatgtcttctctgcggcgatttgggat
ttattagaaaaaacaccagttggtgtaggtgatgaaatccaattaacggatgcaatcgat
atgcttattgagaaagagaccgttgaagcattccatatgacaggcagaagctttgactgt
ggtgacaagattggctatatggaagcctttgtagaatatagtcttcgccatgataaatta
ggcaaagagtttaaagctttcctaaaagatcttgcaaaaaccttataa

DBGET integrated database retrieval system