KEGG   Haemophilus parainfluenzae: PARA_10330Help
Entry
PARA_10330        CDS       T01605                                 

Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PARA_10330
   00052 Galactose metabolism
    PARA_10330
   00500 Starch and sucrose metabolism
    PARA_10330
   00520 Amino sugar and nucleotide sugar metabolism
    PARA_10330
Enzymes [BR:hpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PARA_10330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1039991..1040878
Genome map
AA seq 295 aa AA seqDB search
MKVIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVRSICPKDVTIMHVRQGNAKGLGHAVLCGRPVVGN
EPFAVVLPDVLLADFTANQKKENLSAMIKRFKETQASQIMVAPVAADEVSSYGIADCGGV
ELKGGDSVKINSIVEKPSVEEAPSNLAVVGRYVFSAAIWDLLEKTPVGVGDEIQLTDAID
MLIEKETVEAFHMTGRSFDCGDKIGYMEAFVEYSLRHDKLGKEFKAFLKDLAKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcattattcccgtagcaggtttaggtactcgaatgttacccgcaacgaaagcg
attccaaaagaaatgttaacgcttgtggataaaccacttattcaatatgttgtgaatgag
tgtgttgctgcaggcattaaagaaatcgtcttagtcacacattcttctaaaaatgcgatt
gaaaaccactttgatacgtcttttgaattggaaacaatgcttgagaaacgtgttaaacgt
caacttttggaagaggttcgttctatttgtcctaaagatgtaactatcatgcatgttcgt
caggggaatgcgaaaggcttgggccatgcggtgttatgtggtcgtcctgtcgttggaaac
gagccgtttgcagtggtgttacctgatgtgcttttagcggattttacggcaaatcaaaag
aaagaaaatctttcagcaatgattaaacgttttaaagaaacacaagcaagccaaatcatg
gtagcgcctgttgctgccgatgaagtgagtagctatggtatcgcggattgtggtggagta
gaattaaaaggtggtgatagcgttaaaattaacagcattgttgaaaaaccatctgttgaa
gaggcaccatcaaatcttgctgttgttggacgttatgtcttctctgcggcgatttgggat
ttattagaaaaaacaccagttggtgtaggtgatgaaatccaattaacggatgcaatcgat
atgcttattgagaaagagaccgttgaagcattccatatgacaggcagaagctttgactgt
ggtgacaagattggctatatggaagcctttgtagaatatagtcttcgccatgataaatta
ggcaaagagtttaaagctttcctaaaagatcttgcaaaaaccttataa

DBGET integrated database retrieval system