KEGG   Haemophilus parainfluenzae: PARA_10900Help
Entry
PARA_10900        CDS       T01605                                 

Definition
RuvABC resolvasome regulatory subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PARA_10900
Enzymes [BR:hpr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PARA_10900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1098109..1098720
Genome map
AA seq 203 aa AA seqDB search
MIGRLKGILLEKQPPEILLDVQGVGYELLLPMTSFYDLPEIGQETTLFTHLVVREDAHLL
FGFAQKTDRTLFRELIKTNGVGPKLALAILSAMSVDQFAYAIEREELSKLVKIPGVGKKT
AERLLVELKGKFKDVRQSDFFVESKHIPSTSELRQAESSADEAIAALIALGYKPTDAEKM
VKKVAKADLSSEQLIREALKAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgtttaaaaggcatcttattagaaaaacaacctcctgaaattttgcttgat
gtacaaggcgtcggttacgaattattgttaccaatgaccagtttttatgacttacctgaa
atcgggcaagaaaccacattatttactcatcttgttgtgcgtgaagatgctcatcttctt
tttggatttgcccaaaaaactgaccgcactttattccgtgaattaattaaaaccaatggt
gttggtcctaaattggcactcgcgattttatctgcaatgtcagtagatcagtttgcttat
gctattgaacgagaagaactgtcaaaattagttaaaattcctggtgtgggcaagaaaacg
gccgaacgtttattagtagagttaaaagggaagtttaaggatgttcgccaaagtgatttc
ttcgtggagagcaaacacattccttcaacttcagaattacgtcaagctgaaagctcagct
gatgaagcgattgctgcattgattgcgttaggttataaaccaaccgacgctgaaaaaatg
gtgaaaaaagtggctaaagcggatttaagtagtgagcaattaattcgcgaagccttaaaa
gccgcattataa

DBGET integrated database retrieval system