KEGG   Haemophilus parainfluenzae: PARA_11210Help
Entry
PARA_11210        CDS       T01605                                 

Definition
galactose-1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hpr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hpr00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1125202..1126227
Genome map
AA seq 341 aa AA seqDB search
MLEKTAFNAPDGQPYQLVQLTNSNGMTVQFMDWGATWLSCKVPVNSELREVLLGCKVEDY
PHQTAYLGASIGRYANRIANAQFELGERTIQLVANQGKHQLHGGKEGFDKRRWKVEECGQ
NSVRFSLVSPDGDQGFEGNVQVNVLYTLTDENSVKIEYEAESDKDTALNLTNHAYFNLEN
AELGSDVRNHTLRLNADFYLPVDGEGIPNSPLKHVVNTSFDFRVAKPIAQDFQQGDQVVT
KGYDHSFIVNKAWQKPCVLLTFPNEDLSLEVLTSQAALQVYTGNYLAGTPTREGGTYQDF
SGIALETQCLPDTPNHPEWQNYGGIQKAGERYYQWTEFRFK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaaaaacggcgttcaatgcaccagatggacagccttatcaacttgttcaactc
accaattcaaatggcatgaccgtgcaatttatggattggggagccacttggctttcatgt
aaagtccctgtgaatagcgagttgcgagaagtgttactcggctgcaaagtggaagattat
cctcatcaaactgcttatttgggcgcaagcataggacgctatgcgaaccgtattgctaac
gctcaatttgaattgggtgagcgaacaatccagctggttgcaaatcaaggcaaacatcaa
ttacatggtggtaaagaaggctttgataaacgccgttggaaagtcgaagagtgtggtcaa
aattctgtgcgcttttcccttgtgtctcccgatggtgatcaaggttttgaaggtaatgta
caagttaatgtgctttacacactgactgatgaaaatagtgtaaaaattgaatacgaagca
gaaagcgataaagataccgcacttaatttaacgaaccacgcttatttcaatttagaaaat
gctgagctgggcagtgatgtacgaaatcatacactacgccttaatgcggatttttatctg
ccggttgatggcgaaggtatccctaattcaccacttaaacatgtggtgaatactagcttt
gattttcgtgtagcaaaacccatcgcacaagatttccaacaaggcgatcaagtggtgaca
aaaggttacgatcattcttttatcgtcaataaagcatggcaaaagccttgtgtattattg
actttccctaatgaagatttaagccttgaagtgcttacttcccaagctgcattacaggtt
tatacgggaaactatcttgcaggtactccaactcgtgaaggtggcacttatcaagatttc
agcggcatcgcacttgaaactcaatgcctacccgataccccaaaccatccagaatggcaa
aattatggcggtattcaaaaagctggtgaacgctattaccagtggacagagtttaggttc
aaataa

DBGET integrated database retrieval system