KEGG   Haemophilus parainfluenzae: PARA_11350Help
Entry
PARA_11350        CDS       T01605                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PARA_11350
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PARA_11350
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PARA_11350
Enzymes [BR:hpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PARA_11350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1138168..1139442
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKHPEEQVNFAQAVRQGLGKDQGLFFPETIPALTNIDELLALPLVERSQKILGAL
IGEELPKATLDAMVKNAFTFTAPLEKVEDNIYALELFHGPTLAFKDFGGRFMAQALAAVR
GDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPLQEKLFCTLGGNIRTVAI
NGDFDACQALVKQAFDDAELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKEKRDNVV
VSVPSGNFGNLTAGLIAKTLGLPIKRFIASTNANDTVPRYLESGDWAPKATVATLSNAMD
VSRPNNWPRVEELFKRNGWNLADLGSGMLSDGETEETLKAMYAKGYLCEPHGAIAYQVLK
DQLKADETGIFLCTAHPAKFKESVERILSLDLPLPEALDKHNKLPLLSDEMDNDFAQLRA
YLLK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgtacaatatcaaacaccctgaagaacaagtaaattttgctcaagcagtacgt
caagggcttggcaaagatcaaggtttgttctttcccgaaacgatccccgctttaaccaat
attgatgagttattagccttaccattggttgaacgtagccaaaaaattcttggcgcctta
atcggtgaagaattaccgaaagccactttggatgcaatggtgaaaaatgcgttcaccttt
acggcaccattagaaaaagtggaagacaatatttatgcgcttgaattatttcatgggcca
actttagcatttaaagactttggcggtcgttttatggcgcaggcgctcgctgcagtgcgt
ggcgatggcaaaattaccattttaacagcgacatctggagatactggcgcagcggttgcc
cacgcattttacggtttggaaaatatcaatgtggtgattttatatccgaaaggcaaaatc
agcccattacaggaaaaactattctgtactttaggtgggaatatccgcactgtggcgatt
aatggcgatttcgatgcctgccaagcgttagtcaaacaagcgtttgatgatgcagagcta
cgtcaagcgattggtttaaactcagcaaactctatcaacattagccgtttattagcgcaa
gtttgttattactttgaagctgtagctcaattaccaaaagaaaaacgtgataacgtagta
gtttctgtaccaagtggtaactttggtaacttaaccgcaggtttaattgcaaaaacatta
ggtttaccaattaaacgctttattgcatcaaccaatgcgaacgatactgtgccgcgttat
ttagaatcaggtgactgggcacctaaagcaactgtagccacgctttctaatgcgatggat
gtcagtcgtccgaacaactggccgcgtgtagaagaactattcaaacgcaatggctggaat
ttagctgatttaggttctggtatgttaagcgatggcgaaacagaagaaaccttaaaagca
atgtatgcaaaaggttatttatgtgaaccacacggtgcgatcgcatatcaagtattgaaa
gaccaacttaaagcggatgaaactggtattttcttatgtacggcacatcctgcgaaattt
aaagagtctgtggagcgtattctttcgctcgatcttccactgccagaagcgttggataaa
cacaataaattgccattactttctgatgaaatggataacgattttgcacaactacgtgca
tatttgttgaaataa

DBGET integrated database retrieval system