KEGG   Haemophilus parainfluenzae: PARA_11400Help
Entry
PARA_11400        CDS       T01605                                 

Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hpr  Haemophilus parainfluenzae
Brite
Enzymes [BR:hpr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PARA_11400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1144491..1145774
Genome map
AA seq 427 aa AA seqDB search
MENHYTGEQEKVAKALFDNSCQYCHSPNTPLPFYSKFPIVGDQMQSDIQNGLRAFRLDRL
VEGLKDPSKLSQADLAKLQRVLENNEMPIAKFRHLHWGSKPDEQEKVALLNWIREARKMS
LPKETPNVDADRLVQPIPDSIETDKAKVALGHDLYFDGRLSGDGSIQCHTCHQLDKGGVD
RLETSTGIEGKKGPINAPTVFNAAFNFVQFWDGRAADLADQAKGPPTNPVEMGSHSWDDI
VARFEMDEEFKKEFLKEYPQVTKETLTHAIGEYEKTLITPNSDFDRYLKGDKTALTEQQV
RGYELFKQHKCDTCHTGVAMGGQSYEYMGLYGDYFKDRGTPLTDADEGRFAQTKDPFDMH
RFKVPTLRNIALTAPYFHDASAKELKDAVSAMLKYQSNVKQPAQKDVEDITSFLESLTGE
FKGEKLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcactatacgggagaacaagaaaaagtggcaaaggcgttgtttgataacagc
tgccaatattgtcatagtccaaacacacctcttccattttattcaaaattcccgattgtg
ggtgaccaaatgcaatcggatattcagaatgggcttcgtgctttccgcttagatcgttta
gttgaaggcttaaaagatccgagcaaattatcccaagctgatttagcaaaattacaacgt
gtacttgaaaataacgaaatgccaattgctaaattcagacatcttcactggggaagtaaa
ccagatgagcaagaaaaagtggcgttgcttaactggattcgtgaagctcgtaaaatgtct
ttaccaaaagaaacaccaaatgttgatgccgatcgtttagttcaaccgattccagacagc
attgagactgataaagcaaaagtcgcgttaggtcatgatctttactttgatggacgttta
tcaggcgatggttctattcaatgtcatacttgtcaccaattagacaaaggtggtgtggat
agacttgaaacctcaacagggattgaaggtaaaaaaggtccaattaacgcaccaaccgta
tttaatgctgcgtttaactttgtgcaattctgggatggccgtgcagcagatttagcggat
caagctaaaggtcctccaacaaatccggtagaaatgggctcacactcttgggatgacatc
gtggcacgttttgaaatggatgaagagttcaaaaaagaattcttaaaagaatatccacaa
gtgacgaaagaaaccttaactcacgcgattggtgaatatgaaaaaacattaattacgcca
aatagtgatttcgaccgttatttgaaaggggataaaacagccttgaccgaacaacaagtt
cgcggttatgagttattcaaacaacataaatgcgatacttgtcatactggcgtagcaatg
ggcggacaatcttatgaatacatgggactctacggcgattactttaaagatcgtggtacg
ccattaactgatgcggatgaaggtcgctttgcacaaactaaagatcctttcgatatgcat
cgcttcaaagtgccaactttacgtaacatcgcacttactgcaccctatttccatgatgcg
tcagcaaaagagctaaaagatgctgtgagtgcaatgttgaaataccaaagtaacgtgaaa
cagcctgctcaaaaagatgtggaggacatcacctctttcttagaaagtttgacaggtgaa
tttaaaggtgaaaaattgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system