KEGG   Haemophilus parainfluenzae: PARA_12970Help
Entry
PARA_12970        CDS       T01605                                 

Definition
(GenBank) N-succinyl-diaminopimelate deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hpr  Haemophilus parainfluenzae
Pathway
hpr00300  Lysine biosynthesis
hpr01100  Metabolic pathways
hpr01120  Microbial metabolism in diverse environments
hpr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PARA_12970
Enzymes [BR:hpr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PARA_12970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer DUF2150
Motif
Other DBs
NCBI-ProteinID: CBW15399
UniProt: E1W4V6
Position
1288502..1289635
Genome map
AA seq 377 aa AA seqDB search
MKQKTIELAQALIRRPSISPNDEGCQQLIAERLEKLGFQIEWMPFNDTLNLWAKHGSGEP
VIAFAGHTDVVPTGDETQWTYPPFSADIVDDMLYGRGTADMKGSLAAMIVAAEEYVKANP
NHKGTIALLITSDEEAAAKDGTVRVVETLMARGEKITYCMVGEPSSSKTLGDVVKNGRRG
SITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDNGNEFFPPTSLQIANIHAG
TGSNNVIPGELYVQFNLRYCTEVTDEIIKQKVAEMLEKHGLKYRIDWNLSGKPFLTKPGK
LLDALTTAIEQTTGVTPQAETGGGTSDGRFIALMGAEVVEFGPLNATIHKVNECVNVDDL
AKCGQIYHQMLVNLLDK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaaactattgagcttgcacaagcattaattcgtcgcccctctattagcccg
aatgatgagggctgtcagcaattaattgcggaacgtttagaaaaactcggctttcaaatt
gaatggatgcctttcaacgatacgttaaatttatgggcgaagcatggtagtggtgagccc
gttatcgcttttgcagggcataccgatgtggtgccaacgggagatgaaacacaatggact
tatccgccattttctgccgacattgtggatgatatgctttatggtcgtggtacggcagat
atgaaaggctcattagcagcaatgattgtggcggcagaagaatatgtgaaagccaatccg
aatcataagggaacgattgctttgttgattacttctgacgaagaggcagccgcgaaagat
ggcaccgtacgtgttgtcgaaaccttaatggcgcgcggtgagaaaatcacttattgcatg
gtgggggagccatctagttcaaaaacattaggcgatgtagtcaaaaatggtcgtcggggt
tcgattacaggtaacctctacattcaaggtattcaaggtcatgtggcttatcctcattta
gcggaaaatccaattcataaagccgcacctttcttgcaggaattaaccacttatcaatgg
gataatggcaacgaatttttcccgccgaccagtttgcaaattgccaatattcatgcaggc
actgggagtaataatgtcatccctggtgagctttatgtgcaattcaatttacgttattgt
acggaagtgactgatgaaattattaagcagaaagtggcagaaatgctcgaaaagcatggt
ttgaaataccgtattgattggaatttatcgggtaaaccatttttaacgaaaccgggcaaa
ttattagatgcgttaacgacggctattgagcaaacaaccggagttacaccacaagcagaa
acaggcggtggtacctctgatggacgttttattgcattgatgggcgctgaagtggtggaa
tttgggccgcttaatgcgacgattcataaagtgaatgaatgtgtcaatgtagatgatctt
gccaagtgcggtcagatttatcatcaaatgttagtgaatttattggacaagtaa

DBGET integrated database retrieval system