KEGG   Haemophilus parainfluenzae: PARA_13400Help
Entry
PARA_13400        CDS       T01605                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hpr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1331643..1332146)
Genome map
AA seq 167 aa AA seqDB search
MVQVYIALGSNLNTPTEQLNSALEAISALPNTELKSVSGFYQSKPLGPQDQPDYVNAVAM
IETTRPPLALLDELQRIENEQGRVRLRRWGERTLDLDILLYGDQIIQNERLTVPHYDMKN
REFVIVPLNDIAQDLVLPEGEKVADLVKAFENHQMHKIKNSEKIDRT
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggttcaagtgtatatcgccctaggcagtaatttaaatacgcctactgaacaattaaat
tcggcattagaggcaatctctgcgctacctaatactgaattaaaatcggtgagcggattt
taccaaagcaaaccattaggcccgcaagatcaaccggattatgtaaatgcagtagcgatg
atcgaaaccactcgcccacctttagctttactcgatgaattgcaacgtatcgaaaatgaa
caaggtcgcgtgcgtttacgtcgttggggtgagcgtacactggatttggacattctgctt
tatggcgatcaaatcattcaaaatgaacgcttaacggttcctcattacgatatgaaaaac
cgcgaattcgtgattgtgccacttaatgatatcgcacaagatttggttttacctgaaggc
gaaaaagtcgccgatttggtgaaagcttttgaaaatcatcaaatgcataaaatcaaaaac
agcgagaaaattgaccgcacttaa

DBGET integrated database retrieval system