KEGG   Haemophilus parainfluenzae: PARA_13650Help
Entry
PARA_13650        CDS       T01605                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PARA_13650
   00240 Pyrimidine metabolism
    PARA_13650
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PARA_13650
   03430 Mismatch repair
    PARA_13650
   03440 Homologous recombination
    PARA_13650
Enzymes [BR:hpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PARA_13650
DNA replication proteins [BR:hpr03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PARA_13650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1358554..1358958
Genome map
AA seq 134 aa AA seqDB search
MDRRNLLLNEMGITRWQLYRPEVLQGAVGVSVSEQVKFIVVVNDNLSSSPLFADIRLALE
LKKEDCLCLNFDQIQHITLQHSVRYWLLAENADEIDRTLPYCLNAERVYRSVDWQQFQQD
SQAKRELWQQIQQI
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggatagacgcaatcttcttttaaatgaaatgggaataacccgttggcagctttatcgc
ccagaagtattgcaaggggcggtaggtgtgagtgtttcagaacaagtgaaatttattgtg
gtggtcaatgataatctctcaagttcaccgctttttgcagatattcgacttgcgctagag
ctcaaaaaagaagattgcctttgcctgaatttcgatcaaattcaacatatcacgttacaa
cattctgtacggtattggttattggctgaaaatgctgatgaaatcgaccgcactttgcct
tattgcctaaatgcagagcgagtttatcgctctgttgattggcaacaattccagcaagat
agccaagctaaacgtgagctttggcaacaaatccaacaaatttaa

DBGET integrated database retrieval system