KEGG   Haemophilus parainfluenzae: PARA_14890Help
Entry
PARA_14890        CDS       T01605                                 

Definition
protein disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpr  Haemophilus parainfluenzae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1497916..1498602
Genome map
AA seq 228 aa AA seqDB search
MKKLLTALLITASATAMATDAEIKSKLQALGAKNIEVKDSPVKGLKTAVTDQGILYVSEN
GQYVLQGKMYELTNKGPVDVAGKLLADKVNALKNEMIIYPAKNEKYVVTVFMDITCHYCH
ILHQQVKEYNDLGITVRYLAFPRAGMNETARQMEAIWTSKDPVFALNEAEKGNLPKELKT
PNIVKRHYDLGVQLGVQGTPSIVTSTGEVLGGYLKPHDLLAVLQESAQ
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattactgaccgcacttttaatcacagcttctgccactgcaatggcgactgat
gctgagattaaatcgaagctacaggcattaggtgcgaaaaatattgaagtgaaagattca
ccggtaaaaggccttaaaacagccgtgactgatcaaggcattttatatgtgagcgaaaat
ggtcaatatgttttgcaaggcaaaatgtatgaattaacaaataaaggcccagttgatgtg
gcaggtaaacttttagcggataaagtgaatgcgttaaaaaacgaaatgatcatttatccg
gcaaaaaatgaaaaatatgttgtgaccgtattcatggatattacttgccattattgccat
atccttcatcaacaagtgaaagaatataatgatttaggtattactgttcgttatcttgca
ttcccacgtgccggaatgaatgaaactgctcgccaaatggaagcaatttggacatcgaaa
gatcctgtatttgcattgaacgaagcagaaaaaggtaacttaccgaaagaattgaaaacg
cctaacattgtgaaaagacactatgatttaggtgtacaactcggcgtacaaggtacacca
agtattgtgacttcaacaggtgaagtgcttggcggatatttaaaacctcatgatttatta
gctgtgttacaagaatctgcacaataa

DBGET integrated database retrieval system