KEGG   Haemophilus parainfluenzae: PARA_15270Help
Entry
PARA_15270        CDS       T01605                                 

Definition
dihydrolipoyltranssuccinase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PARA_15270
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PARA_15270
  Amino acid metabolism
   00310 Lysine degradation
    PARA_15270
Enzymes [BR:hpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PARA_15270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1541140..1542366
Genome map
AA seq 408 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKVGETVKRDEVLVEIETDKVVLEVPALSDGVVAEIL
QEEGATVVSKQLLGKLSTQQAGDISSETVKGNEPTPADRQKAAIENSHNNSADQGPAIRR
LLAEHDLDAEKIQGSGVGGRITREDVAREVAKRDAQKAKQDVATEQNTVSTVAYSSRSEK
RVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMKLRKTYGEKFEKQHGVRLGFMSF
YIKAVVEALKRYPEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRNCDKLSMADIEK
QIKSLAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKERPVA
VDGQVVIRPMMYLALSYDHRLIDGRESVGFLVAIKDLLEDPTRLLLEI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaattcttgttccagatttaccggaatccgttgcggatgcaactgttgca
acatggcataaaaaagtgggtgagacagtaaaacgtgacgaagttttagtggaaatcgaa
acagataaagtggtacttgaagtgccagcattaagtgatggcgtagtggctgaaattctt
caagaagaaggcgcaaccgtagtaagtaaacagcttttaggtaaactttctactcaacaa
gcgggcgatatttcatcagagacagtgaaaggcaatgagccaacaccagcagatcgtcaa
aaagcagccattgaaaatagccacaataattcagcagatcaaggtccggctattcgtcgt
ttattagctgaacatgatttagatgcagagaaaattcaaggttctggtgtgggtggccgt
attactcgtgaagatgttgcacgtgaagtagcaaaacgagatgctcaaaaagcgaaacaa
gatgtagcgacagagcaaaatacggttagcactgtggcatatagctctcgttcagaaaaa
cgtgtaccgatgactcgtttacgtaaacgtattgcagaacgtttattagaagctaaaaat
accaccgcaatgctcacgacattcaatgaagtggatatgcagccgattatgaaattacgt
aaaacatacggcgagaaatttgaaaagcaacatggtgtacgtttaggctttatgtctttc
tacattaaagcagtcgttgaagcattaaaacgttatcccgaagtgaatgcttcaattgat
ggtgatgacattgtgtatcacaactattttgatattagcattgccgtttcaaccccgcgt
ggtttagtgacaccagtattacgcaactgcgacaaacttagcatggctgatattgagaaa
caaattaaatcactagcagaaaaaggccgtgatggtaaattaaccgttgaagatttaacg
ggaggtaacttcaccattactaatggcggtgtatttggttctttaatgtccacaccaatt
atcaatccaccacaaagtgcgattttaggtatgcacgccattaaagaacgcccagttgcg
gtagatggccaagttgtgattcgtccgatgatgtatttggcattatcttatgaccaccgc
ttaattgatggtcgtgaatcagtaggcttcttagtggcgattaaagacttattagaagat
ccaactcgtttattattagaaatctaa

DBGET integrated database retrieval system