KEGG   Haemophilus parainfluenzae: PARA_15270Help
Entry
PARA_15270        CDS       T01605                                 

Definition
(GenBank) dihydrolipoyltranssuccinase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hpr  Haemophilus parainfluenzae
Pathway
hpr00020  Citrate cycle (TCA cycle)
hpr00310  Lysine degradation
hpr01100  Metabolic pathways
hpr01110  Biosynthesis of secondary metabolites
hpr01120  Microbial metabolism in diverse environments
hpr01130  Biosynthesis of antibiotics
hpr01200  Carbon metabolism
Module
hpr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PARA_15270
  Amino acid metabolism
   00310 Lysine degradation
    PARA_15270
Enzymes [BR:hpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PARA_15270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CBW15627
UniProt: E1W5I3
Position
1541140..1542366
Genome map
AA seq 408 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKVGETVKRDEVLVEIETDKVVLEVPALSDGVVAEIL
QEEGATVVSKQLLGKLSTQQAGDISSETVKGNEPTPADRQKAAIENSHNNSADQGPAIRR
LLAEHDLDAEKIQGSGVGGRITREDVAREVAKRDAQKAKQDVATEQNTVSTVAYSSRSEK
RVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMKLRKTYGEKFEKQHGVRLGFMSF
YIKAVVEALKRYPEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRNCDKLSMADIEK
QIKSLAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKERPVA
VDGQVVIRPMMYLALSYDHRLIDGRESVGFLVAIKDLLEDPTRLLLEI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaattcttgttccagatttaccggaatccgttgcggatgcaactgttgca
acatggcataaaaaagtgggtgagacagtaaaacgtgacgaagttttagtggaaatcgaa
acagataaagtggtacttgaagtgccagcattaagtgatggcgtagtggctgaaattctt
caagaagaaggcgcaaccgtagtaagtaaacagcttttaggtaaactttctactcaacaa
gcgggcgatatttcatcagagacagtgaaaggcaatgagccaacaccagcagatcgtcaa
aaagcagccattgaaaatagccacaataattcagcagatcaaggtccggctattcgtcgt
ttattagctgaacatgatttagatgcagagaaaattcaaggttctggtgtgggtggccgt
attactcgtgaagatgttgcacgtgaagtagcaaaacgagatgctcaaaaagcgaaacaa
gatgtagcgacagagcaaaatacggttagcactgtggcatatagctctcgttcagaaaaa
cgtgtaccgatgactcgtttacgtaaacgtattgcagaacgtttattagaagctaaaaat
accaccgcaatgctcacgacattcaatgaagtggatatgcagccgattatgaaattacgt
aaaacatacggcgagaaatttgaaaagcaacatggtgtacgtttaggctttatgtctttc
tacattaaagcagtcgttgaagcattaaaacgttatcccgaagtgaatgcttcaattgat
ggtgatgacattgtgtatcacaactattttgatattagcattgccgtttcaaccccgcgt
ggtttagtgacaccagtattacgcaactgcgacaaacttagcatggctgatattgagaaa
caaattaaatcactagcagaaaaaggccgtgatggtaaattaaccgttgaagatttaacg
ggaggtaacttcaccattactaatggcggtgtatttggttctttaatgtccacaccaatt
atcaatccaccacaaagtgcgattttaggtatgcacgccattaaagaacgcccagttgcg
gtagatggccaagttgtgattcgtccgatgatgtatttggcattatcttatgaccaccgc
ttaattgatggtcgtgaatcagtaggcttcttagtggcgattaaagacttattagaagat
ccaactcgtttattattagaaatctaa

DBGET integrated database retrieval system