KEGG   Haemophilus parainfluenzae: PARA_15270Help
Entry
PARA_15270        CDS       T01605                                 

Definition
(RefSeq) dihydrolipoyltranssuccinase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PARA_15270
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PARA_15270
  Amino acid metabolism
   00310 Lysine degradation
    PARA_15270
Enzymes [BR:hpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PARA_15270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1541140..1542366
Genome map
AA seq 408 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKVGETVKRDEVLVEIETDKVVLEVPALSDGVVAEIL
QEEGATVVSKQLLGKLSTQQAGDISSETVKGNEPTPADRQKAAIENSHNNSADQGPAIRR
LLAEHDLDAEKIQGSGVGGRITREDVAREVAKRDAQKAKQDVATEQNTVSTVAYSSRSEK
RVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMKLRKTYGEKFEKQHGVRLGFMSF
YIKAVVEALKRYPEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRNCDKLSMADIEK
QIKSLAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKERPVA
VDGQVVIRPMMYLALSYDHRLIDGRESVGFLVAIKDLLEDPTRLLLEI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaattcttgttccagatttaccggaatccgttgcggatgcaactgttgca
acatggcataaaaaagtgggtgagacagtaaaacgtgacgaagttttagtggaaatcgaa
acagataaagtggtacttgaagtgccagcattaagtgatggcgtagtggctgaaattctt
caagaagaaggcgcaaccgtagtaagtaaacagcttttaggtaaactttctactcaacaa
gcgggcgatatttcatcagagacagtgaaaggcaatgagccaacaccagcagatcgtcaa
aaagcagccattgaaaatagccacaataattcagcagatcaaggtccggctattcgtcgt
ttattagctgaacatgatttagatgcagagaaaattcaaggttctggtgtgggtggccgt
attactcgtgaagatgttgcacgtgaagtagcaaaacgagatgctcaaaaagcgaaacaa
gatgtagcgacagagcaaaatacggttagcactgtggcatatagctctcgttcagaaaaa
cgtgtaccgatgactcgtttacgtaaacgtattgcagaacgtttattagaagctaaaaat
accaccgcaatgctcacgacattcaatgaagtggatatgcagccgattatgaaattacgt
aaaacatacggcgagaaatttgaaaagcaacatggtgtacgtttaggctttatgtctttc
tacattaaagcagtcgttgaagcattaaaacgttatcccgaagtgaatgcttcaattgat
ggtgatgacattgtgtatcacaactattttgatattagcattgccgtttcaaccccgcgt
ggtttagtgacaccagtattacgcaactgcgacaaacttagcatggctgatattgagaaa
caaattaaatcactagcagaaaaaggccgtgatggtaaattaaccgttgaagatttaacg
ggaggtaacttcaccattactaatggcggtgtatttggttctttaatgtccacaccaatt
atcaatccaccacaaagtgcgattttaggtatgcacgccattaaagaacgcccagttgcg
gtagatggccaagttgtgattcgtccgatgatgtatttggcattatcttatgaccaccgc
ttaattgatggtcgtgaatcagtaggcttcttagtggcgattaaagacttattagaagat
ccaactcgtttattattagaaatctaa

DBGET integrated database retrieval system