KEGG   Haemophilus parainfluenzae: PARA_15510Help
Entry
PARA_15510        CDS       T01605                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PARA_15510
Enzymes [BR:hpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PARA_15510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1567799..1569895
Genome map
AA seq 698 aa AA seqDB search
MQMTSSIKQSAEKLGISLSHYDIDGHLIYASPSSIDYFIEQLQFPPNIGKNQPFQDVICA
FENEPIHYDLTAFSFPHDASLRYQLLDEQNQIQFEKTIPYSTALSLPALPFGYYRLVIFI
AQQTFSVQILVSPRTAYQPPLLEQQKAWGVNVQLYSLRSKHNWGIGDFSDLAYLIEKSAE
HGADFVGINPLHLLYPSVPEWASPYSSSSRRWLNFIYLDITALPEFKLAKSVQNWVNSAD
IANLIQSLRDQDTVNYSAVTELKLTALEQLFAFSQRSKSAAIIKRREAFAAYQKEQDEAL
VLQGLFNVLDKIEHADQQAEENTIGWLGWREEWQHLTAAKRKALIKQHKSEIDFFAWLQW
LTEQQLNDLKHLCQKVGMRLGIYGDLAVNSSRGSVDVWSQPELYCVKASVGAPPDPLGPV
GQNWNLPPYNPSQLKATGFAAVITMLRANMQHFGILRIDHVMGLFRLWLIPEGKTAADGV
YVHYPFDELMAILAIESQRNQCLIIGEDLGTVPDEVRWKLNEFRIFSYFVLYFAQRNRQY
PHANEFPRNAYATIGTHDVPSLQSFWHCRDLALFDELNILKGDVLKEKYDQRVIDKQAMI
DSLHRDGYLPPDYHGDALSMAMHDNLNRQIHRYLANSQSALIGVQLENLIGQEISFNLPG
TSTEYQNWQKKLGQSLELIFNDENLKTFFAQINQARKA
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatgacctcatccattaaacaatccgctgaaaaacttggcatttccctttcccat
tatgatattgacgggcatttaatttatgcctcgccaagctctattgattactttatcgag
cagttgcaatttccgccgaatattggaaaaaatcagccgttccaagatgtaatttgtgcc
tttgaaaacgaaccgattcattatgatttaaccgcgttttcttttcctcatgatgcttct
ttgcgttatcaattgctcgacgagcaaaaccaaattcagtttgaaaaaacaattccatat
tcaaccgcactttcgttgcctgctttgccttttggctattatcgtttggtgatttttatc
gcccaacaaactttctcggttcaaattttggtttcaccaagaacagcatatcaaccgcct
ttattagaacaacaaaaagcctggggtgtgaatgttcagctttatagcctccgttccaag
cataactggggtattggtgatttttcagatttagcgtatttgattgagaaaagtgctgag
catggcgcggattttgtcgggattaatccgttacatttactttatccatctgtaccagaa
tgggcgagtccttatagctcttcttctcgtcgttggttgaactttatttatcttgatata
acggcattgccagaatttaaattggcaaaatcggtacaaaattgggttaactctgcggat
atcgccaacttaattcaatctttacgcgatcaagatacggtcaattacagtgcggtaact
gaattaaaactaaccgcacttgagcaactctttgcctttagtcaacgcagtaaatctgct
gcaattatcaaacgtcgtgaagcgtttgcagcttatcaaaaagagcaagacgaggcattg
gttttacaaggcttatttaatgttttagacaaaattgaacatgccgatcaacaagctgaa
gaaaacactatcggttggttaggttggcgtgaagaatggcaacatctcactgctgcaaaa
cgcaaagcattaattaaacaacataaatcggaaattgactttttcgcctggttgcaatgg
ctaaccgaacaacaattgaatgacctaaaacatctttgccaaaaagtaggcatgcgttta
ggcatctatggtgatttagccgtaaatagttcacgcggtagtgtagatgtatggtcgcaa
cctgagctttactgtgtgaaagcctcggtaggtgcaccaccagatccacttggtccagtt
ggtcaaaactggaatttaccgccttacaatccaagccaattaaaagccacaggctttgct
gcagtgattacaatgcttcgtgcaaatatgcagcatttcggtattttgcgtatcgatcac
gtaatgggcttgttccgtttatggttaattccagagggtaaaacagcagctgatggtgtt
tatgtgcattatccgtttgatgagttgatggcaattctagccattgaaagccaacgcaat
caatgtttaatcattggtgaagacttgggtacggtaccagatgaagtgcggtggaaatta
aacgagtttcgtattttctcgtattttgtgttgtattttgctcaacgcaatcgccaatat
ccacatgcgaatgaattcccacgtaatgcttatgcgacgattggtacacatgatgtgcct
tccttgcaaagtttctggcattgccgtgatttagcgttgtttgatgaactcaatatttta
aaaggcgatgtgctaaaagaaaaatatgatcaacgggtcattgataaacaagccatgatt
gatagcttacatcgagatggctatttaccaccagattatcacggtgatgctttaagtatg
gcgatgcacgataatcttaaccgccagattcatcgctatttggctaacagtcaaagtgct
ttaataggtgttcaattagagaacttaatcggacaagaaatttcattcaatctgccaggg
acttcaacagaatatcaaaactggcagaagaaactcggacaatccttagagctgattttt
aatgacgaaaacttaaagacattttttgctcaaattaatcaagctcgcaaagcataa

DBGET integrated database retrieval system