KEGG   Haemophilus parainfluenzae: PARA_15520Help
Entry
PARA_15520        CDS       T01605                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PARA_15520
Enzymes [BR:hpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PARA_15520
Exosome [BR:hpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PARA_15520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1569907..1572096
Genome map
AA seq 729 aa AA seqDB search
MTKLVAQSVINSFFDGKQADPFAVLGMHETHNGIEIRALLPDADKVEVIDKETQSMVVAL
ERVDERGFFSAIVPNVNHFFAYQFKVYWGSDVHLIEDPYRFHPMINDLDQWLLAEGSLLR
PYEVLGAHFTECDGVPGVNFRVWAPNAKRVSLVGDFNYWDGRRHPMRFHPASGVWELFLP
KASLGQRYKFELIDCYGNLRLKADPYAFSSELRPDTASEISMLPDVVEMTEERRKANQRN
QPISIYEVHLGSWRRNLENNFWLDYDQIADELIPYVKHMGFTHIEFLPISEFPFDGSWGY
QPIGLYSPTSRFGTPEGFKRLVEKAHKAGINVILDWVPGHFPSDTHGLVAFDGTALYEHA
DPREGYHQDWNTLIYNYGRNEVKNFLSSNALYWLERFGVDGIRVDAVASMIYRDYSRAEG
EWIPNQYGGRENLEAIEFLKHTNWKIHSEMTGAISIAEESTSFGGVTHPTENGGLGFNFK
WNMGWMNDTLSYMQLDPVYRRYHHDKMTFGMIYQYSENFVLPLSHDEVVHGKCSLLGKMP
GDAWQKFANLRAYYGYMWGYPGKKLLFMGNEFAQGREWNYEESLDWFLLDENHGGPWHKG
VLQLVKDLNGVYQNNTPLFELDGEPEGFDWLVVDDAENSVFAFERKSSNGERIIVISNFT
PVPREGYRIGVNAAGEYEEILNTDSMYYQGSNVGNFGLVESEVIASHGRDNSISVTIPPL
ATIYLKYKA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaattagtcgcccaatcagtaatcaattcattttttgatggcaaacaggctgat
ccttttgctgtattaggcatgcatgaaacccacaatggtattgagatccgcgctttatta
cctgatgcggataaagtggaagtgattgataaagaaactcaatccatggtggttgcttta
gaaagagtggatgagcgtggctttttctccgctattgtgccaaatgtgaaccactttttt
gcttatcaatttaaagtgtattggggctcggatgtacatcttattgaagatccttaccgt
ttccatccaatgattaatgatttagaccaatggttattggctgaaggttcgttattacgt
ccttatgaagtattaggtgcacactttaccgaatgtgatggtgtaccaggcgtaaatttc
cgtgtatgggctccgaatgcgaaacgtgtttcgttggttggtgatttcaactattgggat
ggtcgccgtcatccaatgcgtttccatccagcaagtggtgtgtgggagttattcttacca
aaagctagccttggtcaacggtataaatttgaattaattgattgctatggcaaccttcgt
ttaaaagccgatccttatgcatttagctctgaattacgtccggataccgcatcagaaatc
agcatgttgcctgatgtagtagaaatgacagaggagcgtcgtaaggcgaaccaacgtaac
caaccaatttccatttacgaagtacatttgggatcatggcgtcgtaatttagaaaataat
ttctggcttgattacgaccaaattgccgatgagcttatcccttatgtaaaacacatgggc
tttacccatattgagtttttaccaatttccgaattcccatttgatggttcttggggttat
caaccgatcggtttgtattctccaactagccgttttggtacaccagaaggctttaaacgc
ttagtcgaaaaagcccacaaagcaggtattaatgtgattttagactgggtaccaggacat
ttcccaagtgacactcatggtttagtagcctttgatggtactgccttatatgagcatgct
gaccctcgtgaaggctatcaccaagattggaatactttaatttataactatggccgtaat
gaagtgaaaaatttcttatccagtaatgcattgtattggttagaacgctttggtgtggat
ggtattcgtgtagatgcggtagcgtcaatgatttatcgcgattacagccgtgctgaaggg
gaatggatcccaaatcaatatggcggccgtgaaaacttagaagctattgaattcttaaaa
cataccaactggaaaatccattctgaaatgaccggtgctatttccattgcggaagaatct
acttctttcggtggcgtaacccatccaacagaaaatggcgggcttggattcaatttcaaa
tggaacatgggctggatgaacgacaccctaagttatatgcaacttgatcccgtttatcgt
cgttatcatcatgacaaaatgaccttcgggatgatttatcaatacagcgaaaactttgtg
ttaccactttctcacgatgaagtcgtacacgggaaatgttcgttactcggcaaaatgccg
ggtgatgcatggcaaaaatttgctaacttgcgcgcttactacggttatatgtggggctat
ccaggcaaaaaattattattcatgggtaatgaatttgctcaaggtcgtgaatggaattat
gaagaaagtttggattggttcttacttgatgaaaatcatggtggtccatggcataaaggc
gtattgcaattagttaaagatttgaacggcgtttatcaaaacaatacaccgctctttgaa
ttagacggcgaacctgaagggtttgattggttagtggtggacgatgcggaaaattcagtc
tttgcttttgaacgtaaaagcagtaatggcgaacgcattattgtgatcagtaacttcaca
cctgtgccacgcgaaggttatcgcattggggttaatgcagcgggtgaatacgaagaaatt
ttgaatactgactcaatgtattatcaaggttcaaatgtaggtaatttcggcttggtagaa
agcgaagtgatcgcaagtcacggacgtgacaattcgattagcgtgaccattccgccactc
gcaacaatctatttaaaatataaagcataa

DBGET integrated database retrieval system