KEGG   Haemophilus parainfluenzae: PARA_16140Help
Entry
PARA_16140        CDS       T01605                                 

Definition
exonuclease V (RecBCD complex), alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hpr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1635367..1637301
Genome map
AA seq 644 aa AA seqDB search
MLSLLKSLQEQGVITQGDYYFAQLIADKQKDKGYAEPVQNLAILLAALCNWSYTQGNTCC
VLDRFLERNLFGLAYRHTETDFLSLINEKIGSLPVSKWQSALAGHIAFTQDPENQIAPLA
FQFGAIYFYRAWQDEFRVAQYIKNALKNNRTLSVEPQQIRALLDRYFPQQQAQIDWQKVA
VATAVKTPFSVITGGPGTGKTTTVTRLLCVLQELFGGKLHIKLVAPTGKAAARLTESIEN
ALAQMPISDELRASIPKTAETLHRLLGVRPFTDSVKYHAHNPLQIDVLVVDETSMIDLPM
MAKLVQALKPETRLILLGDQAQLASVEAGAVLGEIAQFLTLDYSPAQADYIHTTTGYTVP
TSDEHSPLRDAICHLTFSRRFRDDSGIKQLAEQIQQGKGEGSVATFAEYPQELHFHHFDE
EQDVKESVRQVVKSAVENYRVYLTQLQTYFAQKKDLNAKFIDEKGNEKTYAEAILDRFNS
VRFLTALRASALGVEELNREIALALRAEKLLWFRQEDDWYIGKPIMITENDHNVKLYNGD
IGLCLAKGKVWFGNREVSTSRIPAHEPAFMMTIHKSQGSEFDHTVIVLPTEPNPVLSREL
VFTGVTRAKNQLSVFANEKIWQSAVRNTVKRQSGLGKLLQEEEE
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttaagcctattaaaatccttgcaagaacaaggtgtgattactcaaggcgattattat
tttgctcaattaattgctgataaacaaaaagataaaggctatgccgaacccgtacaaaat
ttagcgattttattagccgcactttgcaactggagctatacacaaggcaatacttgttgt
gtgttagatcgtttcttagaacgtaatttatttggtttggcttatcgtcatactgaaacg
gattttttgtcgcttatcaatgaaaagattggttcgcttcctgtatccaaatggcaatca
gccttagcggggcatattgcttttacacaagatcctgaaaatcagattgcgcctctcgca
tttcaatttggggctatttatttctatcgagcttggcaagatgagttccgcgtggcgcaa
tatattaaaaatgccttgaaaaataaccgcactttatcggtagaaccgcaacaaattcgg
gcattattagatcgttatttccctcaacaacaagcacaaattgattggcaaaaagtagca
gtcgcaacagcagtgaaaactccattttctgtgattacaggtggaccgggaacagggaaa
accacgacagtcactcgattattatgtgtattacaggaattatttggtggcaaacttcat
attaaattggttgcgccaacgggaaaagcggcggctcgtttaacggaatccattgaaaat
gccttggcacaaatgccgatttcagatgagttacgtgcatccattccgaaaaccgcagaa
acgttgcatcgtttattaggcgttcgaccttttaccgatagcgtgaaatatcatgcacat
aatccactgcaaattgatgtgttagtggtggatgaaacttcgatgattgatttgccgatg
atggcgaaactggtgcaagcgttgaagcccgaaacgcgtttgattttattgggcgaccaa
gctcaattggcttcagtggaagctggcgcggtattaggtgaaattgcacagtttttaacg
ctagattatagccccgctcaagctgattatatccatacaacaacaggctataccgttcca
acttcagatgaacatagtccgctacgtgatgccatttgccatttaacctttagtcgtcgt
ttccgagatgattcgggcataaaacaacttgctgagcaaattcaacaaggaaaaggtgag
ggcagtgtggcaacctttgcggaatatccacaagagttacatttccatcattttgatgaa
gagcaagacgttaaagaatctgttcgtcaagtggtgaaaagtgcggtcgaaaattaccgt
gtttatttaacgcaacttcaaacttattttgctcagaagaaagatctcaatgcaaaattt
atagatgaaaagggcaatgagaaaacttatgcggaagcaattttagaccgttttaattcg
gtgagatttttgaccgcacttcgcgcttcggcattaggtgtggaagagttaaatcgagaa
attgctttagcattgcgtgcagaaaaactactttggttccgccaagaggatgattggtat
atcggtaagccaattatgattaccgaaaacgatcataacgtgaaactgtataacggtgat
attggcttgtgtttagctaaaggcaaagtgtggttcggcaatcgagaagtttctaccagt
cgtattcccgctcacgaacctgcatttatgatgacgattcataaatcccaaggttcggag
tttgatcataccgttatagtgttaccaacagaacccaatccagtgctttcacgagagctg
gtatttaccggtgttacccgtgcgaaaaatcaactttccgtatttgctaatgaaaaaatc
tggcaaagtgcggtcagaaatacggtaaaaagacaaagtggtttaggaaagttattacag
gaagaagaggagtaa

DBGET integrated database retrieval system