KEGG   Haemophilus parainfluenzae: PARA_16930Help
Entry
PARA_16930        CDS       T01605                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PARA_16930
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PARA_16930
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PARA_16930
Enzymes [BR:hpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PARA_16930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1733446..1734642
Genome map
AA seq 398 aa AA seqDB search
MSEPLLNPYFGEFGGMYVPEILVPVLQQLEKAFVEAKDDPEFQREFQDLLKNYAGRPTAL
TLCRNLTKGTKAKIYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLDMPCSVYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSCSLKDACCEAMRDWSA
NYENTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQILEKEGRLPDAVIAAVGGGSNAIG
MFTDFIDEKGVRLIGVEPAGHGIESGEHGAPLGHAKVGIYFGMKSPLMQTEDGQIEESYS
ISAGLDFPSVGPQHAYLQSIGRAEYPSITDDEALNAFQALAKHEGIIPALESSHALAHAL
KMIHQEPNKEQILVVNLSGRGDKDIFTVDKVLKEKGMQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaccccttttaaacccttatttcggtgaatttggcggaatgtacgtaccggaa
attctcgtaccggtgctgcaacagctagaaaaagcttttgttgaagcaaaagacgatcct
gaattccaacgtgaatttcaagatttacttaaaaattatgcgggcagaccaaccgcactt
actctttgccgtaatttaaccaaaggcactaaagcaaaaatttatttaaaacgtgaagat
ttacttcacggtggtgcccataaaactaaccaggttttaggtcaaattttattggcaaaa
cgcatgggtaaaacgcgtattatcgctgaaaccggtgcgggccaacatggtgttgcgact
gcccttgcttgtgcaatgttagatatgccttgcagtgtttatatgggggcgaaagatgta
gaacgtcaatcaccaaacgtattccgtatgcgtttgatgggcgcagaagtgattcctgtt
caaaaaggctcttgctcattgaaagatgcatgctgtgaagcgatgcgtgattggtcagct
aattatgaaaatacccattatttattgggtacagcggcaggccctcatccattcccaacc
attgtacgtgaattccaaaaaatgattggtgaagaaactaaacgtcaaattttagaaaaa
gaaggccgtttaccggatgctgtcatcgcggcagttggtggtggttcaaatgcgattggt
atgtttactgattttattgatgaaaaaggtgttcgcttaattggtgtggaacctgctggt
catggtatcgaaagtggtgaacatggtgcgccattaggtcatgcaaaagtcggcatttat
ttcggtatgaaatcacctttgatgcaaactgaagatggccaaatagaagaatcctactct
atttctgcaggattggacttcccttctgtaggacctcaacatgcttacttgcaaagtatt
ggtcgtgctgaatacccaagtattacagatgatgaagcgttaaacgctttccaagcatta
gcaaaacatgaagggattattcctgcattggaaagttctcatgcattagcacatgcgcta
aaaatgattcatcaagaaccgaataaagaacaaatcttagtggtgaatctctctggtcgt
ggtgataaagatattttcaccgttgataaagttttaaaagaaaaaggaatgcaataa

DBGET integrated database retrieval system