KEGG   Haemophilus parainfluenzae: PARA_16940Help
Entry
PARA_16940        CDS       T01605                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PARA_16940
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PARA_16940
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PARA_16940
Enzymes [BR:hpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PARA_16940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1734642..1735448
Genome map
AA seq 268 aa AA seqDB search
MSRFETKFAELAAKKEGAFVPFVTLCDPTFDRSFEIICTLVENGADALELGFPFSDPLLD
GPVIQAANNRALNAGHSTEDSFKLLAKVRSKYPEIPISLLLCANLIFAKGLDNFYQCCAE
VGVDAVLVADIPLLAKEDYIQAAKKHGIQPVFICPPNADAKTVQGVAENSEGYTYLVSRA
GVTSAENQAHAANLDTLVEQLKAHKAPPILQGFGIAQPAQVKEALQLGATGAISGSATVK
IIERNLDNQAQCLSELAEFVRNMKTATK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgaaactaaatttgcagaacttgcagcgaaaaaagaaggggcttttgta
cctttcgtgacattatgcgatccaacatttgatcgctcttttgagattatttgcacgtta
gtcgaaaatggtgcagatgcgttggaattaggctttccattttctgatccattattagac
ggccctgttattcaagcggctaataaccgtgcgctcaatgcgggccatagcactgaggat
agctttaaattactcgctaaagtgcggtcaaaatatccagaaattccgattagtttactt
ctttgtgcgaatttaatttttgcgaaaggcttagataatttctatcaatgttgtgcagaa
gtcggcgtagatgcggttttagtggcagatattccactattggcaaaagaagactatatt
caagccgctaaaaaacatggcattcaacctgtctttatttgcccaccaaatgctgatgcc
aaaacggtgcaaggcgttgctgaaaacagcgaaggctatacctatttagtgtctcgtgca
ggtgtaacaagtgcagagaatcaagctcatgccgcaaacttagatacacttgtagaacaa
cttaaagcccacaaggctccaccaattctacaaggttttggtattgctcaacctgctcag
gtgaaagaagcccttcaacttggtgcaacaggcgcaatttcaggctctgcaacggtaaaa
atcattgaacgaaacttagataatcaggctcaatgcttatctgaacttgccgaatttgtt
cgcaatatgaaaacggcaacaaaataa

DBGET integrated database retrieval system