KEGG   Haemophilus parainfluenzae: PARA_17150Help
Entry
PARA_17150        CDS       T01605                                 

Definition
7,8-dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PARA_17150
Enzymes [BR:hpr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PARA_17150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1753794..1754570)
Genome map
AA seq 258 aa AA seqDB search
MGILNFTPDSFSDSGQFFSLDKALFQVEKMLNEGATIIDIGGESTRPMAEEVSETEELQR
VIPLVEAVQKRFECWISVDTSKAIVMQEAAKVGMDLINDIRALREPGALEIAGQLNLPTC
IMHMQGQPRTMQTNPHYDDVVQDVYQFLTDRTQACLAAGIAKENIIWDMGFGFGKTVQHN
YKLLQQLAHFCESGYPVLAGLSRKSMIGAVLDKPVTERVVGSVAGALIAAQNGSTILRVH
DVAATADALKVWQATQQA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggggattttgaatttcacacctgattcgttttctgatagcgggcagtttttcagtcta
gacaaagcattatttcaagttgaaaaaatgctgaacgaaggtgcaacaattattgatatt
ggcggtgaatcaactcgtccaatggcggaagaagtgtctgaaactgaagaattgcaacga
gtgatacctttggttgaagccgtgcaaaaacgttttgagtgttggatttcagtggatacc
tctaaagcaattgtgatgcaagaagcggcgaaggtcggcatggatttaatcaatgatatt
cgtgctctacgtgaacctggtgcactcgaaatagcaggacagttgaatttacccacttgt
attatgcatatgcaaggacaacctcgtacaatgcaaactaatccgcattacgatgatgtg
gttcaagatgtttatcagtttttaactgatagaactcaagcttgtttagcagcaggcata
gccaaagaaaatattatttgggatatggggtttggttttggtaaaacagtacagcataac
tacaagcttttacaacagttggctcacttctgtgaaagcggatatcctgttttagcaggg
ctttcacgcaaatcgatgattggtgctgtattagataagcccgtgactgaacgtgttgta
ggaagtgtagctggcgcattaattgcggcacaaaatggatcgacaattttgcgtgtacat
gatgtagcagcaacagcagatgccttgaaggtatggcaggcaacgcaacaagcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system