KEGG   Haemophilus parainfluenzae: PARA_17970Help
Entry
PARA_17970        CDS       T01605                                 

Definition
hypothetical protein
Orthology
K06177  
tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase [EC:5.4.99.28 5.4.99.29]
Organism
hpr  Haemophilus parainfluenzae
Brite
Enzymes [BR:hpr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.28  tRNA pseudouridine32 synthase
     PARA_17970
    5.4.99.29  23S rRNA pseudouridine746 synthase
     PARA_17970
Transfer RNA biogenesis [BR:hpr03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    PARA_17970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1846483..1847172)
Genome map
AA seq 229 aa AA seqDB search
MTALMKLDIIYQTDDFIIIYKPCGISVHKDQSKIGLTTLLARQLNVPQVWLVHRLDKVTS
GLLILALNAESAAEFFRLFSEHHIQKTYLALSNQKPKKKQGLLVGDMQKARNGAWKLCQS
KENPAITRFESVSCEPNLRLFILKPQTGKTHQLRVAMKSLGSPILGDALYGKNTEKIDRT
YLHAARLQFEFKGKAFDVFTPPKEGEWWHRENVQSQIQKFGSANAEPKK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgcacttatgaaattagacattatttatcagaccgatgattttatcattatttat
aagccttgtgggataagtgtgcataaagatcaaagtaaaattggtttaaccactttgctt
gccagacagcttaatgtgccacaagtctggcttgtacatcgattagataaagtgacatca
ggtttacttattttggcactaaatgccgaaagtgcggctgaatttttccgacttttttct
gaacatcatatccaaaagacttatcttgcactcagcaatcagaaacccaaaaagaaacaa
ggattgcttgtcggggatatgcaaaaggccagaaacggcgcctggaaactttgccaatcg
aaagaaaatcccgcgattacgcgttttgaaagtgtaagttgtgagcccaatttacgatta
tttatcttaaagccacaaacaggtaaaacccatcaattgcgtgtagcgatgaaaagctta
ggtagccccattttaggtgatgcgctttatggtaaaaacactgaaaaaattgaccgcact
tatttacatgctgcaagattgcaatttgaatttaaaggtaaagcatttgatgtgtttacc
cctccgaaagaaggagagtggtggcatcgtgagaacgttcaatctcagattcaaaaattt
ggctcagcaaatgctgagccaaagaaataa

DBGET integrated database retrieval system