KEGG   Haemophilus parainfluenzae: PARA_18040Help
Entry
PARA_18040        CDS       T01605                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PARA_18040
Enzymes [BR:hpr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PARA_18040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1854743..1855399)
Genome map
AA seq 218 aa AA seqDB search
MNAISPDAENVRRALVAKGIETPMIDPTQCKDERREAIASHMREVMKLIGLDLRDDSLEE
TPNRLAKMFIDEIFSGMDYANFPKMTKIKNQMKVSEMVQVNDITLTSTCEHHFVTIDGNV
AVAYYPKDWVIGLSKINRIVAFFAQRPQVQERLTEQLLIAFQTILETDDVAVYVKATHFC
VKARGVKDTHSYTVTSAYGGVFLEDRETRKEFLSSIQK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgatttcacctgatgcggaaaatgtccgccgagccttggtagctaaaggcatc
gaaaccccaatgattgacccgactcaatgtaaagatgagcgccgagaggcgattgcttcg
catatgcgtgaagtgatgaaattgattgggttagatctacgtgatgatagcctagaagaa
acaccaaatcgcttagctaaaatgtttattgatgaaattttcagtggaatggattatgcc
aatttcccgaaaatgacgaaaatcaaaaaccaaatgaaagtgagcgaaatggtgcaagtg
aatgacatcaccttaaccagtacttgcgaacatcattttgtgacgattgatggtaatgtc
gccgtcgcctattacccgaaagattgggtgattgggctgtctaaaatcaatcgcattgtg
gcgttttttgcgcaacgcccacaagtgcaagagcgtttaaccgaacagcttttaatagca
tttcaaacgattttagaaacggatgatgtggccgtttatgtgaaagcgacacatttctgt
gtgaaagcgcgtggggtaaaagatactcatagttataccgtgacatcagcctatggtggg
gtctttttagaagatcgcgaaactcgaaaggaatttttatcttccattcagaaataa

DBGET integrated database retrieval system