KEGG   Haemophilus parainfluenzae: PARA_18940Help
Entry
PARA_18940        CDS       T01605                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PARA_18940
Enzymes [BR:hpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PARA_18940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1960330..1961835)
Genome map
AA seq 501 aa AA seqDB search
MLTRSSGVLMHITSLPNAFGIGSFGQSAYDFVDFLVETKQTYWQILPLTTTSYGDSPYQS
FSAVAGNTHLIDFDLLTQMGLLKESDYASVNFGDDPTSVDYERIFYARRPILETAVKNFL
ENQSFQADFKHFEKSNRLWLDDFAEFMAIKEHFGNQALQKWDDKKAVARDPSALEKYRTM
LAEQIQYFKVTQYFFFKQWTELKNYANQKGIQIIGDMPIYVAADSVEVWTKPELFQLDEE
RNPLFVAGVPADQFSATGQLWGNPLYAWEEHKKQGYAWWIHRIEESFKIYDVLRIDHFKG
FSDYWQVDGKAEVAKDGSWQPGPGYDLFKAVKEQLGDLPIIAEDLGNIDDKARKLLTDCN
YPGMKILQFGFEDVSGESLDSPHYCIPHSIVYTGTHDNDVTNGWYNSLTEQQQQYINDYT
HRHEDESICQAMIRQLFATVSNTAIATMQDVLDLPASSRMNVPSTIGGNWQWRMQQSDLT
QDKKDFLAKMTTLYQRANQEK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcttactcgttcaagtggtgttcttatgcacattacctcactaccaaatgcatttggg
attggtagttttgggcaatccgcttatgattttgtcgattttttagttgaaaccaaacaa
acttattggcaaattcttccactcactaccaccagttatggtgattctccttatcaatct
ttctctgcggttgcaggtaatactcatcttattgattttgatttattaacccaaatgggc
ttgttgaaagaatcggattatgcttcggtcaattttggtgatgatccaactagcgtggat
tatgaacgtatcttctacgcgcgccgtccgattttagaaacagccgtgaaaaatttttta
gagaatcaatcattccaagctgatttcaaacacttcgagaaaagcaatcgtttatggttg
gatgattttgctgagtttatggcaattaaagagcattttggcaatcaagcattgcaaaaa
tgggatgataaaaaagctgtggctcgagatccaagtgcattggaaaaatatcgcaccatg
ttagcggagcaaattcagtactttaaagtgacgcaatatttcttcttcaaacaatggact
gaattaaaaaattacgcaaatcaaaaaggcattcagatcatcggtgatatgccgatttac
gtggctgcagatagcgtagaggtttggacaaaaccagaactcttccaattagatgaagaa
cgcaatccgctttttgtcgcgggggtcccagccgatcaattcagtgcaacaggacaactt
tggggcaatccgctttacgcttgggaagaacataaaaaacaaggctacgcttggtggatt
caccgcattgaagaaagcttcaaaatttatgatgtactacgtatcgaccatttcaaaggt
ttctctgattattggcaagtagacggaaaagcagaggttgctaaagatggtagctggcag
ccaggcccaggttatgacttatttaaagccgttaaagagcaattgggcgatttaccgatt
attgccgaagatttaggtaatattgatgacaaagccagaaaattgcttacagactgtaac
tatcctggcatgaagattctgcaatttggctttgaagatgttagcggagaaagcttagat
agcccgcattattgcatcccgcattccattgtttataccggcacacatgataacgatgtg
accaatggttggtataacagcctgactgaacaacagcagcaatatatcaatgattatacg
catcgccatgaggatgaatcgatttgtcaagcgatgattcgtcagctttttgcaaccgtt
agcaataccgcgattgcaacaatgcaagatgttttagatttgccagcgagttcaagaatg
aacgtgccttcaacaattggtggaaactggcaatggagaatgcagcaatcagatttaacg
caagataaaaaagactttttagcaaaaatgaccacgttatatcaacgtgcgaatcaggaa
aaataa

DBGET integrated database retrieval system