KEGG   Haemophilus parainfluenzae: PARA_19840Help
Entry
PARA_19840        CDS       T01605                                 

Definition
beta-D-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hpr00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:hpr00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2057948..2060974)
Genome map
AA seq 1008 aa AA seqDB search
MSLPRYFEDPQTLHVNTTPHHAYFIPFSSTESAVKKTREFSPYFTLLNGEWDFAYFESYT
HLPQNFLHFSFTDKIPVPSNWQNHGYDNHQYTNVNYPFPFDPPYVPIENPCGLYHRVFNV
EINPEKRYLLNFEGVDSCLFVYVNQQFVGYSQISHCTSEFDITDFLQQGENHLHVLVLKW
CDGSYLEDQDKFRMSGIFRDVYLLARERNYLQDFFIQMRLNQELNKAQLHVACQFAEREQ
SISWQLFDPQGKLIIEQKGHAFHAEIENAQLWHAENPRLYTLILQYGSEVICQKVGLRHI
EVKNGVMLFNGQAIKFKGVNRHDSDPKTGYVISREQALQDLRLMKQHNFNAIRTAHYPNA
PWFTELCDEYGFYVIAESDIESHGTNAVYVESPETSILLGVKTEIDHDAIRQKTIDNYCY
MARSPEFNQAILDRTYANVERDKNRPSVVIWSLGNESGYGENFEQAAAWVKQRDQSRLVH
YENAIFQHSAHQNDTSNLDFHSEMYTSTEELDAYFTDAQNQKPYLFCEYLHAMGNSCGDT
EDYFQAMEQHAGACGGFVWEWCNHSPYLSNSSKMGYGGDFNDTPNDGNFCADGLVTADRQ
IQSNLLEYKNVYRPLRATLKNGHIELKNYLDFTDAAEAISIHYQITEDFAVIQEGQIDDL
NIAPKSTALLPLPLPASNGSLQVLTLTYHQKTETGLIPQGHSLGFDQIILSEQSQFFTDE
LKSNLQPISVSEYANLILVKVADVEYQFDQYKGTIQQISKDGKPWLNQPTDFNIWRAPLD
NDSLIKAHWLAAGYDRATSRVYDYRLTEQKSAVEISFKLGLVAVSKARILTLNVVYRIEQ
NGLLQINIHAEKQPHLPFLPRFGLRFFLNQGFNQVEYVGYGPTESYLDKHQATVFGRYKT
TRESNHVPYLKPQENGSHYGCREVKVVNSADCFTVQSHTPFSMNVSPYSQEELGSKKHQY
DLEKSGSTILCVDYKMSGVGSNSCGPALKAQYRLNETEWDWAISLQIN
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgcctcgttattttgaagatccgcaaaccttgcacgtgaataccacaccacat
catgcttattttattcctttttcttcaacagaaagtgcggtcaaaaagacacgagaattt
tctccttactttaccttactaaatggtgaatgggattttgcttattttgaaagctatact
cacttgcctcaaaatttccttcatttttcatttacagataaaatccccgttccttccaat
tggcaaaatcatggttacgataatcatcaatataccaacgtaaattatcctttccctttt
gatcccccttatgtgcctattgaaaatccttgcggtttgtatcaccgcgtttttaatgtt
gaaatcaatccagaaaaacggtatctcttaaattttgaaggggtagatagctgcttattt
gtctatgtgaatcaacaatttgtgggctacagccaaattagtcattgcactagcgaattt
gatattactgactttttacaacaaggggaaaatcatttacatgttttagtgctgaaatgg
tgtgatggcagttacttggaagaccaagacaaattccgaatgtccggtatttttcgagat
gtttatctgttagcgcgagaaagaaattacttacaagatttctttattcaaatgcgattg
aatcaagagcttaacaaagctcaattacatgtagcctgtcagtttgcagaacgcgaacaa
tccatttcttggcaattatttgatcctcaaggcaaattgataattgaacagaaagggcat
gcatttcatgctgaaattgaaaatgcgcaattatggcatgcagagaaccctcgtttatac
acgttgattttgcaatatggatcagaagtgatttgccaaaaggtcggcttgcgtcatatc
gaagtgaagaatggcgtaatgttatttaatgggcaagcgattaagtttaaaggcgttaat
cgtcacgatagcgatccgaaaaccggttatgtcattagtcgagaacaagcgttgcaagat
ttacgcttaatgaaacagcataattttaatgccattcgcacagcgcactatcctaatgca
ccttggtttactgaattatgtgatgaatatggtttttatgtgattgcagaaagtgatatt
gaatcgcacggcacgaatgcagtttatgtagagtcgccagaaacaagcattttgttaggg
gtaaaaacagagattgatcatgacgcaattcgtcaaaaaacaatcgacaattattgctat
atggctcgaagccctgaatttaatcaagccattttagaccgcacttatgccaatgttgag
cgagataaaaatcgtccttctgttgtgatttggtcattgggaaatgaaagtggttatggt
gagaattttgagcaagccgccgcttgggtgaaacagcgcgatcaaagtcgcttagtgcat
tatgaaaatgcgatctttcaacattcagcacatcaaaatgacacatccaatttagatttt
catagcgaaatgtacaccagtacggaagaattggatgcttattttaccgatgcccaaaat
caaaagccgtatcttttctgtgaatatttgcatgcgatggggaattcttgcggggataca
gaagattatttccaagcgatggaacaacatgcaggcgcttgtggtggctttgtgtgggag
tggtgcaatcattccccttatttgtcaaactcaagcaagatgggctatggcggggatttt
aatgacacgccgaatgacggtaatttttgtgctgatggattagtgacggcagaccgtcaa
attcaaagcaatttgttggaatacaaaaatgtgtatcgtccacttcgcgctaccttaaaa
aatggtcatattgaactcaaaaattatttggattttacggatgcggcagaggctatttcg
attcattatcaaatcaccgaagattttgctgttatacaagaaggccaaatagatgattta
aacattgcaccaaaatcaaccgcacttttacctttaccattgccagcaagtaacggttca
ttacaagttttaacattgacctatcatcaaaaaacagaaacgggcttaattccccaaggg
catagtttgggatttgatcagatcattttgtcagagcaatcacaattcttcacagatgag
ctcaagtcaaatcttcaaccgatttctgtttcagaatatgctaatttaattttagttaaa
gtggcagatgttgaatatcagtttgatcaatataaaggcactattcaacaaattagtaaa
gatggtaagccgtggttgaatcaacctactgatttcaatatttggcgagcgcctttagat
aatgatagtttaattaaagcacattggcttgctgcaggttacgatcgtgccacgagtcgt
gtttatgattaccgcttaaccgagcagaaaagtgcggttgaaattagctttaaattgggg
ctagtcgccgtatcaaaagcgcgaattttgacattgaatgtggtgtatcgtattgaacaa
aatgggctgcttcagattaatattcatgctgaaaaacaaccgcacttgccattcttacca
cgctttggtttgcgtttcttccttaatcaaggatttaatcaagtggagtatgtaggctat
ggtccaacggaaagttatctggataaacatcaggccacggttttcggtcgttataagaca
acgcgagaaagtaatcatgtgccttatttaaaaccacaagaaaatggcagtcactatggt
tgtcgtgaggtgaaggtggtgaattcggctgattgttttaccgtgcaaagtcatacgcct
tttagcatgaatgtttccccttattctcaagaagaattgggcagtaaaaagcaccaatat
gatttggagaaaagtggcagtacgatcttgtgtgtggattataaaatgagtggggtaggc
tccaattcttgtggaccagcattaaaagcgcaatatcgtttgaatgaaacagaatgggat
tgggcgatttcattgcaaattaactaa

DBGET integrated database retrieval system