KEGG   Helicobacter pylori Shi470: HPSH_00490Help
Entry
HPSH_00490        CDS       T00742                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hps  Helicobacter pylori Shi470
Pathway
hps00260  Glycine, serine and threonine metabolism
hps00750  Vitamin B6 metabolism
hps01100  Metabolic pathways
hps01110  Biosynthesis of secondary metabolites
hps01120  Microbial metabolism in diverse environments
hps01230  Biosynthesis of amino acids
Module
hps_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSH_00490
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPSH_00490
Enzymes [BR:hps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPSH_00490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACD47560
Position
complement(89652..91112)
Genome map
AA seq 486 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFETLEWQDCLNLSYNELVECVFERL
GLEIPKGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNGALKTRQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIDKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTYSPAMDILKSSNVERALFDLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEVYAKHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
STTLLALNEQKKNDNDKTALETLKNSYNTPDSQRLDDLFERGIKHQEVLKLNEIKSSILL
WLENTH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgttctttgaaagaaaaaaagattgattttattgaagcaata
ttaaaccccaacgccccaaaaggcgggctttacactttagagcattttgaaacattagaa
tggcaggattgtttgaatctgagctataacgagctggtagaatgcgtgtttgagcggttg
ggattagagattcctaagggtttattaacaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcgctcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttacagcctttagcgagcttgttt
tctaatctagcggtaggaaaaaatgaaaagtatttaatgcttgtttctaccagtggcgat
accggccctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttggtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacggcgctttaaaaacgcgccaattaaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgcgttaggggcgttttatgccaaaaaaatgggtttgaatatt
gataaaatcaaggttgtaaccaacagcaatgatgttttaagggagtttatagaaacaggg
cgttacgatttaacccatcgttctttaaagcaaacctactcgccggctatggatatttta
aaaagctctaatgtggaaagagcgctttttgacctctttgggtttgaacgcacactagaa
ttgatgcaagctttagaagaagagaaattttatgcattaaagcctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagcttgtttgaaaacaatccaa
gaagtttatgcaaagcaccaatacctgattgaccctcacaccgccaccgctttaaacgcc
agcttgaaaaccaatgaaaaaacccttgtttctgccaccgcctcttatgaaaaattcccc
agcaccacccttttagccctaaacgaacaaaagaaaaacgataacgacaaaaccgcccta
gaaacgcttaaaaacagctacaataccccagatagccaacgccttgatgatttatttgaa
agaggaatcaagcaccaagaggttttaaaactcaatgagatcaaatcttctatccttttg
tggctagaaaacacgcattaa

DBGET integrated database retrieval system