KEGG   Helicobacter pylori Shi470: HPSH_00565Help
Entry
HPSH_00565        CDS       T00742                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hps  Helicobacter pylori Shi470
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hps00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
106915..107478
Genome map
AA seq 187 aa AA seqDB search
MFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQLNENTLLVLHDKIDYRWKEASLDSPI
HASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPRDYLGYRSLGEEISIFNPKDYDSWQE
RADTEILRQLQESKKYFVFIKGCGIFAYHRELSKLMEVFDLIENSCKVLRLGDLMDYCYN
DDPRLSV
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaaagggtttttttgggctttatcaaggctctatttcagcgcgcattggcacg
aatcaatttgtgatcaataaaagaaacgctgtttttgatcaattgaatgaaaacacctta
ttggttttgcatgataagattgattatcgctggaaagaagcgagcctggattcacccatt
catgcgagcgtgtatagggagttcttggacgctaaattcatcgcttatgcgcgccctcct
tatagtttggcgtattccttgcgccacaaccgattgctccctagggattatttagggtat
cgttctttgggcgaagaaatttccatttttaatcccaaagactatgacagctggcaagaa
agagcggatacagaaattttacgccaactgcaagagagcaaaaaatattttgtcttcatt
aaggggtgcgggatttttgcctaccacagagagctttctaaactcatggaagtttttgat
ttgattgaaaactcatgcaaggttttacgactaggcgatttaatggattattgctataat
gatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system