KEGG   Helicobacter pylori Shi470: HPSH_01095Help
Entry
HPSH_01095        CDS       T00742                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hps  Helicobacter pylori Shi470
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPSH_01095
  Amino acid metabolism
   00300 Lysine biosynthesis
    HPSH_01095
Enzymes [BR:hps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HPSH_01095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(204050..205201)
Genome map
AA seq 383 aa AA seqDB search
MDALEITQKLISYPTITPKECGIFEYIKSLFPTFKTLECGENGVKNLFLYRIFNPPKEHT
EEKHAKESVKPLHFCFAGHIDVVPPGNHWQSDPFKPIIKEGFLYGRGAQDMKGGVGAFLS
ASLNFNPKTPFMLSVLLTSDEEGPGIFGTRLMLEKLKEKDLLPHMAIVAEPTCEKILGDS
IKIGRRGSINGKLILKGTQGHVAYPQKCQNPIDALASVLPLISGVHLDDGDEYFDPSKLV
ITNLHAGLGANNVTPASVEIIFNARHSLKTTKESLKEYLEKVLKNAPHTLELESSSSPFI
TASHSKLASVLKENILKTCHTTPLLNTKGGTSDARFFSAHGIEVVEFGVINDRIHAIDER
VSLKELELLEKVFLGVLENLSEK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggacgctttagaaatcacccaaaagctcatcagctaccccaccattacgcccaaagaa
tgcggtatttttgaatacattaaatcgctttttcctacttttaaaactctagagtgtgga
gaaaatggcgtgaaaaacctttttttataccgcatttttaacccccccaaagagcacaca
gaagaaaagcatgcaaaagaaagtgttaagcccttgcacttttgctttgcagggcatatt
gatgtcgtgcctcctggaaatcattggcaaagcgatccctttaaacccattattaaagag
gggtttttatacggccgtggggcacaagacatgaaaggaggcgtgggggcgtttttgagc
gcgagtttaaattttaaccctaaaacccctttcatgctttctgttttactcacaagcgat
gaagaagggccagggatttttggcactagacttatgttagaaaaactcaaagaaaaagat
ttgctccctcacatggcgattgtggctgaacccacttgcgaaaaaatcctaggcgatagc
atcaaaatcggccgaagaggctctattaatggcaaactcattttaaaaggcactcaaggg
catgtagcttacccgcaaaaatgccaaaaccccattgatgcgctcgcttctgttttgccc
ttgatttcaggagtccatttagacgatggcgatgaatattttgacccttcaaaattggtt
atcaccaacttgcatgcagggttaggggcgaataatgtaacgcccgcaagcgtagaaatc
atctttaatgcacgccattctttaaaaaccaccaaagaaagcttgaaagaatatttagaa
aaggttttaaaaaacgcgcctcacactttagaattagaatcaagcagttcgcctttcatc
acagcttctcattcaaagcttgccagcgttttaaaagaaaatattttaaagacatgccat
accactccccttttaaacaccaaaggcggcacgagcgatgcgcggttttttagcgctcat
ggcatagaagtggtggaatttggcgttattaatgacagaatccatgccattgatgaaagg
gtgagcttgaaagaattagagcttttagaaaaagtgtttttgggggttttagagaattta
agcgagaagtag

DBGET integrated database retrieval system