KEGG   Helicobacter pylori Shi470: HPSH_01715Help
Entry
HPSH_01715        CDS       T00742                                 

Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
hps  Helicobacter pylori Shi470
Pathway
hps00290  Valine, leucine and isoleucine biosynthesis
hps00770  Pantothenate and CoA biosynthesis
hps01100  Metabolic pathways
hps01110  Biosynthesis of secondary metabolites
hps01130  Biosynthesis of antibiotics
hps01210  2-Oxocarboxylic acid metabolism
hps01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    HPSH_01715
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HPSH_01715
Enzymes [BR:hps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     HPSH_01715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C NAD_binding_2 Rossmann-like AdoHcyase_NAD F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ACD47793
UniProt: B2USG1
Position
328458..329450
Genome map
AA seq 330 aa AA seqDB search
MALPVYYDKDIDLGVIQSLQVGIIGYGAQGEAQALNLRDSKVKVRIGLYQGSLSVPKAKA
EGFEVLEVKELVQQSDLIMALLPDELHKEVLEKEVIPFLKEGQIVGFAHGFSVHFNQVVL
PKGVGAILVAPKGPGSALREEYLKNRGLYHLIAIEQESSKNNAKAVALSYAKAMGGGRMG
VLETSFKEECESDLFGEQAVLCGGLEAIIRMGFETLIKAGYPEELAYFECVHEVKLVADL
LHYKGVEGLRKHISNTAEFGAIKNREPMGNLLEKRMQKILKKIQNGSFAKDFLLEKSLNY
PRLNTERKALKETKIEQIGEILRAPFNHKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
ttggcattacccgtttattatgataaagacattgatttaggcgttatccaatccttacaa
gtgggtattatcggctatggcgcgcaaggagaagcccaagcgctcaatttgagagactct
aaagtaaaagtgcgtattggcttgtatcaagggagtttgagcgttccaaaagcaaaagca
gagggctttgaggtgctagaagtcaaagaattagtccaacaatctgatctgatcatggca
cttcttccggacgaattgcataaggaagtgttagaaaaagaagtgatcccttttttaaaa
gaggggcaaattgtgggctttgcccatggctttagcgtgcatttcaatcaggttgttctc
ccaaaaggcgtgggcgcgattttagtcgcgccaaaagggcccgggagcgctttaagagaa
gaataccttaaaaataggggtttataccatttgatcgccatagagcaagaaagctcaaaa
aataacgctaaagcggtggctttaagctatgctaaagcgatgggcggggggagaatgggg
gttttagaaacgagctttaaagaagaatgcgagagcgatttattcggcgagcaagcggtt
ttgtgcggagggttagaagcgattattaggatgggatttgaaactttaattaaggcagga
taccctgaagaattagcctattttgaatgcgtgcatgaagtgaaattagtggcggattta
ttgcattataagggggtagagggcttaaggaaacacatttctaacaccgctgaatttgga
gcgattaaaaatagagagcctatgggaaatctgctagaaaaacgcatgcaaaaaatctta
aaaaagattcaaaacggctcattcgctaaggattttttactggaaaagagtttgaattac
cccaggttaaacacagagaggaaagcccttaaagagactaaaatagaacaaattggggaa
attttacgcgccccattcaatcataaaaaataa

DBGET integrated database retrieval system