KEGG   Helicobacter pylori Shi470: HPSH_01715Help
Entry
HPSH_01715        CDS       T00742                                 

Definition
ketol-acid reductoisomerase (EC:1.1.1.86)
Orthology
K00053  
ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
hps  Helicobacter pylori Shi470
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    HPSH_01715
   01230 Biosynthesis of amino acids
    HPSH_01715
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    HPSH_01715
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HPSH_01715
Enzymes [BR:hps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase
     HPSH_01715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
328458..329450
Genome map
AA seq 330 aa AA seqDB search
MALPVYYDKDIDLGVIQSLQVGIIGYGAQGEAQALNLRDSKVKVRIGLYQGSLSVPKAKA
EGFEVLEVKELVQQSDLIMALLPDELHKEVLEKEVIPFLKEGQIVGFAHGFSVHFNQVVL
PKGVGAILVAPKGPGSALREEYLKNRGLYHLIAIEQESSKNNAKAVALSYAKAMGGGRMG
VLETSFKEECESDLFGEQAVLCGGLEAIIRMGFETLIKAGYPEELAYFECVHEVKLVADL
LHYKGVEGLRKHISNTAEFGAIKNREPMGNLLEKRMQKILKKIQNGSFAKDFLLEKSLNY
PRLNTERKALKETKIEQIGEILRAPFNHKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
ttggcattacccgtttattatgataaagacattgatttaggcgttatccaatccttacaa
gtgggtattatcggctatggcgcgcaaggagaagcccaagcgctcaatttgagagactct
aaagtaaaagtgcgtattggcttgtatcaagggagtttgagcgttccaaaagcaaaagca
gagggctttgaggtgctagaagtcaaagaattagtccaacaatctgatctgatcatggca
cttcttccggacgaattgcataaggaagtgttagaaaaagaagtgatcccttttttaaaa
gaggggcaaattgtgggctttgcccatggctttagcgtgcatttcaatcaggttgttctc
ccaaaaggcgtgggcgcgattttagtcgcgccaaaagggcccgggagcgctttaagagaa
gaataccttaaaaataggggtttataccatttgatcgccatagagcaagaaagctcaaaa
aataacgctaaagcggtggctttaagctatgctaaagcgatgggcggggggagaatgggg
gttttagaaacgagctttaaagaagaatgcgagagcgatttattcggcgagcaagcggtt
ttgtgcggagggttagaagcgattattaggatgggatttgaaactttaattaaggcagga
taccctgaagaattagcctattttgaatgcgtgcatgaagtgaaattagtggcggattta
ttgcattataagggggtagagggcttaaggaaacacatttctaacaccgctgaatttgga
gcgattaaaaatagagagcctatgggaaatctgctagaaaaacgcatgcaaaaaatctta
aaaaagattcaaaacggctcattcgctaaggattttttactggaaaagagtttgaattac
cccaggttaaacacagagaggaaagcccttaaagagactaaaatagaacaaattggggaa
attttacgcgccccattcaatcataaaaaataa

DBGET integrated database retrieval system