KEGG   Helicobacter pylori Shi470: HPSH_02135Help
Entry
HPSH_02135        CDS       T00742                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase FolK
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hps  Helicobacter pylori Shi470
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPSH_02135
Enzymes [BR:hps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HPSH_02135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
406953..407441
Genome map
AA seq 162 aa AA seqDB search
MREILTSRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKILSSPV
YINPPFGYTKQPNFYNATIILKTSLSLHHFFALVFYIERRFGRQRKRDFKDAPRTLDIDI
IAFNQVILRQNDLTLPHPKWSERDSVLVPLALQQILFKKGEW
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcgagagatccttactagccgctttttccctagcctttttaaaaaaaggcttgatttt
tctaacagggtggttttagggctaggatctaatcttaaaaatcctttgaaaatattaaaa
aattgttttttatattttaaaaatcatagtaaaatcgggaaaattctttcttcgcctgtt
tatatcaacccgccttttggttacacgaagcagcctaacttttataacgctacgattatc
cttaaaacatctttaagtttgcaccattttttcgctctggttttttatatagaaaggcgt
tttgggcgccaaaggaagcgcgattttaaagacgctccaagaactttagacattgatatt
atcgctttcaatcaagtcattttaagacagaacgatttgactttacctcatcctaaatgg
agtgaaagggattcggtgttagtgccgttggctttgcaacaaattctttttaaaaaaggg
gagtggtga

DBGET integrated database retrieval system