KEGG   Helicobacter pylori Shi470: HPSH_03350Help
Entry
HPSH_03350        CDS       T00742                                 

Definition
DNA gyrase subunit A
Orthology
K02469  
DNA gyrase subunit A [EC:5.99.1.3]
Organism
hps  Helicobacter pylori Shi470
Brite
Enzymes [BR:hps01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.3  DNA topoisomerase (ATP-hydrolysing)
     HPSH_03350
DNA repair and recombination proteins [BR:hps03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      HPSH_03350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(636147..638627)
Genome map
AA seq 826 aa AA seqDB search
MQDNLINETKNIVEVGIDSSIEESYLAYSMSVIIGRALPDARDGLKPVHRRILYAMHELG
LTSKVAYKKSARIVGDVIGKYHPHGDNAVYDALVRMAQDFSMRLELVDGQGNFGSIDGDN
AAAMRYTEARMTKASEEILRDIDKDTIDFVPNYDDTLKEPDILPSRLPNLLVNGANGIAV
GMATSIPPHRIDEIIDALVHVLENPNAGLDEILEFVKGPDFPTGGIIYGKAGIIEAYKTG
RGRVKVRAKVHVEKTKNKEIIVLDEMPFQTNKAKLVEQISDLAREKQIEGISEVRDESDR
EGIRVVIELKRDAMSEIVLNHLYKLTTMETTFSIILLAIYNKEPKIFTLLELLRLFLNHR
KTIIIRRTIFELEKAKARAHILEGYLIALDNIDEIVRLIKTSQSPEAAKDALMERFTLSE
IQSKAILEMRLQRLTGLERDKIKEEYQNLLELISDLNGILKSEDRLNEVVKTELLEVKEQ
FSSQRCTEIQEVYENIDIEDLIANEPMVVSMSYKGYVKRVDLKAYERQNRGGKGKLSGNT
YEDDFIENFFVANTHDILLFITNKGQLYRLKVYKIPEASRIAMGKAIVNLISLAPDEKIM
ATLSTKDFSDERSLAFFTKKGVVKRTNLSEFDSNYNGMRAIVLDEGDELVSAKIVDKNAK
HLLIASYLGIFIKFSLEDVREIGRTTRGVRGIRLNENDFVVGAVVISDDSNKLLSVSENG
LGKQTLAEAYREQSRGGKGIIGMKLTQKTGNLVSVISVDDENLDLMILTASAKMIRVSIQ
DIKETIGRNTSGVKLIDTADKVVYANSCPKEEEPENSENPPTQLFE
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgcaagataatttaatcaatgaaacaaaaaatattgtagaagtggggattgattcttct
attgaagaaagctatttagcttattcaatgagcgtgatcatagggcgcgctttaccggac
gctagagatggcttaaagcccgtgcataggcgcattttgtatgcgatgcatgaattaggt
ctcacttccaaagtcgcttataaaaaaagcgctaggatcgtgggtgatgtgattggtaaa
taccacccccatggcgataacgcggtttatgatgcgctagtgagaatggcgcaagatttt
tctatgcgtttggaattggtggatgggcaaggcaactttggctctattgatggcgataat
gctgcggcgatgcgttacactgaagccagaatgaccaaggcgagtgaagaaattttaagg
gatattgataaagacaccattgattttgtgcctaattacgatgacaccttaaaagagccc
gatattttaccaagccgtctgcctaaccttttagtcaatggggctaatgggatcgctgta
gggatggcgacttctatcccccctcacaggattgatgaaatcatagacgctttagtgcat
gtcttagaaaaccctaacgctggattagatgaaattttggaatttgtcaaagggcctgac
tttcccactggcgggatcatttatggcaaggcgggtattattgaagcctataaaacgggg
cgagggcgcgtgaaagtgcgcgccaaagtgcatgtggaaaagacgaaaaataaagaaatc
atcgttttagatgaaatgccttttcaaaccaataaagccaaattagtggaacaaatcagc
gatttagcgcgagaaaaacaaattgaaggcattagcgaagtgcgcgatgagagcgataga
gagggcattagagtggtgattgaattaaaaagagacgcgatgagtgaaattgtcttaaac
cacctctacaaactcaccaccatggagaccacttttagtatcattttactcgctatttat
aataaagagcctaagattttcacgcttttagagttgttgcgcctttttttaaaccacaga
aaaaccattattataagacgcactatttttgaattagagaaggctaaagctagagcgcat
attttagagggctatttgatcgcattagacaatattgatgaaatcgtgcgactcattaaa
acaagccaaagcccagaagcggctaaagacgccttaatggagcgttttactttgagcgaa
atccagagcaaagccattttagaaatgcgtttgcagcgcttaacaggccttgaaagagat
aaaatcaaagaagaataccaaaacttgctagagcttattagtgatctcaatggcatttta
aagagcgaagatcgcttgaatgaagtcgtcaaaacagagcttttagaagtcaaagagcaa
ttttcttctcaaaggtgcactgaaattcaagaagtttatgaaaatattgacatagaagat
ttgatcgctaatgagcctatggtggtgagcatgagctataaaggctatgtgaaaagagtg
gatttaaaagcttatgaaaggcaaaatcgtggcggtaagggcaagctttcaggcaacact
tatgaagacgatttcattgaaaacttttttgtggctaacacgcatgatattttgctcttt
atcaccaacaaggggcagttgtatcgtttgaaagtctataagatcccagaagcgagccgg
atcgctatgggtaaagccatcgtgaatttaatctcgctcgctcctgatgaaaagatcatg
gcaaccctaagcaccaaagactttagtgatgaacgctctttagctttcttcaccaaaaaa
ggcgtggtgaagcgcaccaatttgagcgaatttgacagcaactataacggtatgagagcg
attgttttagatgaaggcgatgaattggtgagcgcaaaaattgtggataaaaacgctaaa
catttgctcatcgcatcgtatttgggcattttcattaaattctctttagaagatgtgcgc
gagatcggaagaactactcgtggggttagagggatcaggctgaatgaaaatgattttgtt
gtcggcgcggtcgttattagcgatgacagcaacaagcttttgagcgtgagtgaaaacggg
cttggcaagcaaactttagccgaagcgtatagagagcaatctcgtggaggtaaggggatt
attggcatgaagctcactcaaaagaccggcaatctagtgagcgttatcagtgtggatgat
gaaaacctggatttgatgatccttactgcaagcgcgaaaatgatcagagtttctattcaa
gatattaaagaaaccatcggaagaaatactagtggggtaaaactcatagacaccgctgat
aaagtcgtgtatgccaattcttgccctaaagaagaagagccagaaaattcagaaaaccct
cccacacaattgtttgaatga

DBGET integrated database retrieval system