KEGG   Helicobacter pylori Shi470: HPSH_03630Help
Entry
HPSH_03630        CDS       T00742                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hps  Helicobacter pylori Shi470
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HPSH_03630
   00052 Galactose metabolism
    HPSH_03630
   00500 Starch and sucrose metabolism
    HPSH_03630
   00520 Amino sugar and nucleotide sugar metabolism
    HPSH_03630
Enzymes [BR:hps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HPSH_03630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(697700..698521)
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDHPSVLKQMISLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctacggcacgcgctttttgccgatcact
aaaaccattcctaaagaaatgctgcccattgtggataagcctttaatccaatacgctgta
gaagaagcgatggaagcaggctgtgaagtgatggcgatcgttacaggcagaaacaagcgc
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcactaac
aaagaaaacgccctaaaaagcattcgtaacattatagaaaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggattagggcatgcgattttaaccggagaagccctcataggc
aatgagccttttgcggtgattttagccgatgacttatgcataagccatgatcacccaagc
gtgctaaagcaaatgatttcattgtatcaaaaataccaatgctccattgtagccattgaa
gaagtggcactagaagaagtctcaaaatacggcgtgattaggggcgaatggttagaagag
ggggtgtatgagattaaagacatggtggaaaaaccaagccaagaagacgccccaagcaat
ctagccgtgatagggcgctacattctaaccccggatatttttgaaattttaagcgagacg
aaaccgggcaaaaacaatgaaatccaaatcacagacgccttactcactcaagccaaaaga
aaacggatcatcgcttaccaattcaagggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttgtaa

DBGET integrated database retrieval system