KEGG   Helicobacter pylori Shi470: HPSH_05600Help
Entry
HPSH_05600        CDS       T00742                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hps  Helicobacter pylori Shi470
Brite
Enzymes [BR:hps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HPSH_05600 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 NodS Peptidase_S24 Methyltransf_32 Methyltransf_4 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: ACD48528
Position
1105365..1105994
Genome map
AA seq 209 aa AA seqDB search
MKSIKNHLMCEEINKRFSLHPKVREAMESIEREVFVPAPFKHFAYTLNALSMQAQQYISS
PLTVAKMTQYLEIDHVDSVLEIGCGSGYQAAVLSQIFRRVFSIERIESLYIEARLRLKTL
GLNNVHVKFADGNKGWDQYAPYDRILFSACAKNIPQALIDQLEEGGILVAPIQENNEQVI
KRFVKQNNALRVQKVLEKCLFVPVVDGVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaagagtattaaaaaccatttgatgtgtgaagaaatcaataagcgtttcagtttgcac
cccaaagtgagagaagccatggaaagcattgaaagggaagtttttgtgccagcccctttt
aaacattttgcttacactttaaacgcgctttctatgcaagcgcaacaatacatttcttcg
cccctaaccgtggccaaaatgacgcaatatttagaaattgatcatgtggatagcgtgcta
gaaattggctgcgggagcggctatcaagcggcggtgctttctcaaattttcaggcgcgtt
tttagcattgaaaggattgaaagcctgtatatagaagcgcgtttgcgccttaaaactctc
ggtctaaacaacgttcatgttaaattcgctgatgggaataagggctgggatcaatacgcc
ccctatgataggattttgttctctgcttgcgctaaaaatatccctcaagcgctgattgat
cagcttgaagaaggcgggatattagtcgcgcccattcaagaaaataacgagcaagtgatc
aaacgctttgtgaagcaaaataacgccttgcgcgtccaaaaagtgttagagaaatgcttg
tttgtgcctgttgtagatggggtgcaataa

DBGET integrated database retrieval system