KEGG   Helicobacter pylori Shi470: HPSH_05665Help
Entry
HPSH_05665        CDS       T00742                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hps  Helicobacter pylori Shi470
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPSH_05665 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSH_05665 (glk)
   00052 Galactose metabolism
    HPSH_05665 (glk)
   00500 Starch and sucrose metabolism
    HPSH_05665 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPSH_05665 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPSH_05665 (glk)
   00524 Butirosin and neomycin biosynthesis
    HPSH_05665 (glk)
Enzymes [BR:hps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPSH_05665 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1117262..1118272
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLPCKDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLDLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcgcgc
tttggcttagaagtcgccccacgacagattgaatgcattgaagtcttgccatgcaaagat
tttgaaagcttgagcgatgcggtgcgattctatctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgctgtggctacgcccattatgggggattttgtccaa
atgactaacaaccactggactttttctattgaaacgacacggcaatgtttggatttaaaa
aaattgcttgtcatcaacgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaaatgcgagatcaacgctcctaaagcgatttta
ggaccaggaactgggcttggggtaagcactcttatccaaaacagcgatggctctttgaaa
gtcttgcccggtgaaggggggcatgtgagcttcgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaatcatgtgagcgcggaaaggtttttgagcggg
agcggtttggtgttgatttatgaagccctgtctaagcgcaaaggcttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgactttggatactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagggggggcgtgtatttgtgtggggggattatcccg
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaaccccgggactt
gatggggcgggcattgcgttagagaattatttactgcatgataagatataa

DBGET integrated database retrieval system