KEGG   Helicobacter pylori Shi470: HPSH_06370Help
Entry
HPSH_06370        CDS       T00742                                 

Definition
dihydropteroate synthase FolP
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hps  Helicobacter pylori Shi470
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hps00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1255819..1256961
Genome map
AA seq 380 aa AA seqDB search
MILKRLNPDALKNALLKTGSEKPAQTHMHKKGVSFVFEIQHLPLSATLILKQEAISVGGD
FATPRDCILAKEPFYDGVLIVSASQLERLIVKCHSQPFGLKNLAQELKSHLKAKKPNNPQ
IMAILNLTPDSFYEKSRFDSKKALEEIYQLLKKGITLIDIGAASSRPQSETIDPKIEQDR
LKEILLEIKSQKLYQCAKFSIDTYHAKTAQMALEHYFSILNDVSGFSSIKMLEVAKDYKP
TCILMHTQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLSLHLMALQNGASILRA
HDIDEHIDLIKVFKSLEETN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattttaaaacgccttaaccctgatgcgctcaaaaacgcccttttaaaaaccggatca
gaaaaacccgctcaaacccatatgcataaaaaaggcgttagctttgtttttgaaatccag
catctgcccttaagcgcaacgctcattttaaaacaagaggccatcagcgttgggggcgat
ttcgccacgccaagagattgtattttagctaaagagcctttttatgatggggtgttgatt
gtgagcgctagccagttagaacgccttattgtcaagtgccactcccaaccctttgggctt
aaaaatttagcgcaagaattaaaaagccaccttaaagccaaaaaacctaacaacccacag
atcatggcaattttgaatctcacgccggatagtttttatgaaaaaagccggtttgatagc
aaaaaagcgcttgaagaaatctatcaattattaaaaaagggtatcacgctcattgatata
ggcgcagccagttcaagaccacagagtgaaaccattgatccaaaaatagagcaagatcgc
ttaaaagaaattttattagaaatcaaatcccaaaaactctaccaatgcgctaaattcagc
atagacacctaccatgctaaaaccgcccaaatggctttggagcattatttttccatcctt
aatgatgtgagcggttttagtagtattaaaatgctagaagtcgcaaaagattacaagccc
acttgcattttaatgcacactcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatctgtttgatgaaatggatcgcttctttaaggaaaaactagaggttttagaaaaa
tacgcgcttcaagatattattttagatatagggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccacttcctcaaattcaaaaaacccttattggtg
ggagcaagtcgtaaaaacacgatcgggcttatcaccgggcgtgaagttcaaaaccggctc
gctggcactttaagcttgcatttaatggcactgcaaaatggagcgagtattttaagagcg
catgacattgatgagcatatagacctcatcaaggtgtttaagagtttagaagaaacaaat
tga

DBGET integrated database retrieval system