KEGG   Helicobacter pylori Shi470: HPSH_06605Help
Entry
HPSH_06605        CDS       T00742                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hps  Helicobacter pylori Shi470
Pathway
hps00010  Glycolysis / Gluconeogenesis
hps00030  Pentose phosphate pathway
hps00051  Fructose and mannose metabolism
hps00052  Galactose metabolism
hps00230  Purine metabolism
hps00500  Starch and sucrose metabolism
hps00520  Amino sugar and nucleotide sugar metabolism
hps00521  Streptomycin biosynthesis
hps01100  Metabolic pathways
hps01110  Biosynthesis of secondary metabolites
hps01120  Microbial metabolism in diverse environments
hps01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSH_06605
   00030 Pentose phosphate pathway
    HPSH_06605
   00051 Fructose and mannose metabolism
    HPSH_06605
   00052 Galactose metabolism
    HPSH_06605
   00500 Starch and sucrose metabolism
    HPSH_06605
   00520 Amino sugar and nucleotide sugar metabolism
    HPSH_06605
  Nucleotide metabolism
   00230 Purine metabolism
    HPSH_06605
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPSH_06605
Enzymes [BR:hps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPSH_06605
    5.4.2.8  phosphomannomutase
     HPSH_06605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ACD48721
Position
1299804..1301180
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSTFSIGVELGKIMREYDKSVFVGHDARVHGRSLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEIDNIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKETPKKANALEAYQRYLIKDFEHLKNLKYKIALDFGN
GVGALGLEPILKALSIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMQENAISIGFAF
DGDADRIAMLSSHHVYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINAFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLFEQTPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEALKNPPNNFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKKVLLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatatgatattagaggcatttaccccaccactttagat
gaaaagagcacctttagtatcggcgtggagttagggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgatcgctttttgaagctttgagc
gccgggttacaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatagacaacatccaatgccccaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaagctttaaaagacacgcttttaaacgccaagcatgaaata
aaacccctaaaagaaacaccaaagaaagccaatgccctagaagcgtatcagcgctatttg
atcaaggattttgagcatttaaaaaaccttaaatacaagatcgccctggattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaagcattgattttagcagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcaagaaaacgctatttctataggctttgctttt
gatggcgatgcggacaggattgcgatgttaagctctcatcatgtttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgatcaatgcttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgtttgaacaaaccccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacctgcaagaagcgcttaaaaacccgccaaataat
ttccctaaaatcaaagaaataatcagcattgatggcgtgagggtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaacaacggcgttagaatataaaaaagtgctactcaatttgctagagaaataa

DBGET integrated database retrieval system