KEGG   Helicobacter pylori Shi470: HPSH_06615Help
Entry
HPSH_06615        CDS       T00742                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hps  Helicobacter pylori Shi470
Pathway
hps00260  Glycine, serine and threonine metabolism
hps00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hps01100  Metabolic pathways
hps01110  Biosynthesis of secondary metabolites
hps01130  Biosynthesis of antibiotics
hps01230  Biosynthesis of amino acids
Module
hps_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSH_06615 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSH_06615 (trpA)
Enzymes [BR:hps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPSH_06615 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ACD48723
UniProt: B2UV41
Position
complement(1301830..1302618)
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFETLKKQEKMAFIPFVTLGDPNYALSFEIVKTLIASGVSALELGFAFSDPVADG
VTIQASHLRALKHASMAKNFQLLRAIRDYNPHIPIGLLAYANLIFSYGVDNFYAQIKECG
VDSVLIADMPLIEKELVLKSAQKHQIKQIFIASPNASNKDLERAAMHSQGYIYTLARSGV
TGASRILENDASAIIKTLKTFSPTPALLGFGISKKEHIKNAKGMGADGVICGSALVKIIE
ENLNDENAMLERIKGFIGEMIS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagatataaaaacatgtttgaaacattaaaaaaacaagaaaaaatggcgtttatccca
tttgtaaccttgggcgatcctaattatgcattgagttttgaaatcgttaaaactttaatt
gctagcggggtgagcgctttagaattggggtttgctttctctgatccggtagcggatggc
gttaccatacaagcgagccatttaagggcgttaaaacacgctagcatggctaaaaatttc
cagcttttaagggcgatcagagattacaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggc
gtggatagcgttttaatagcggacatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaacaccagattaaacaaatctttatcgccagccccaatgcgagtaataaagat
ttagaacgagccgctatgcattcgcagggctatatctacactctggctaggagtggggtt
acaggagcgagccgtattttagaaaatgacgcgagcgctattattaaaaccttaaaaact
tttagccccacaccggccttactgggctttggcatttctaaaaaagaacacataaaaaac
gctaaaggcatgggcgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttgaacgatgaaaacgccatgctagaaagaattaaagggtttataggagaaatg
atctcttaa

DBGET integrated database retrieval system