KEGG   Helicobacter pylori Shi470: HPSH_06620Help
Entry
HPSH_06620        CDS       T00742                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hps  Helicobacter pylori Shi470
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPSH_06620
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSH_06620
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSH_06620
Enzymes [BR:hps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPSH_06620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1302615..1303796)
Genome map
AA seq 393 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEEFQKEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLGLKCVIFMGAKDIKRQEMNVFRMRLLGAEVEEVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMMGDEVKSQILEKENRLPDYVIACVGGGSNAIGVFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIIESHSISA
GLDYPGVGPEHSYLKESARAIYESASDFEALEAFSLLCQKEGIIPALESSHALAYALKLA
QKCEEESIMVVNLSGRGDKDLSTVYNALKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagagttagaacaggcgtttgatgcgtgtttgaaagatgaggaattccaa
aaagaatatttccatcttttaaaagattttgtgggccgtcctagccccttaaccttgtgt
caaaatatcgtttctaaccctaaagttaagctttatctaaaacgagaagatttaatccat
ggcggggcgcataagactaatcaagccttagggcaagcccttttagcgaaaaaaatgggt
aaaacaaggattattgctgaaacaggtgctgggcagcatggcgtggcgacggctatcgct
tgcgcgttgttgggtttaaaatgcgtgatttttatgggggctaaagacatcaagcgccag
gaaatgaatgtttttagaatgcgtttattaggtgctgaagtagaagaggttaattcaggg
agcgcgacgcttaaagacgctgtgaatgaagccttaagggattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgccgggccacacccttaccccacaatggttaaa
acctttcaaaaaatgatgggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctataggggtatttagt
gcgtttttaaacgataaagaggttaaactcataggcgtagagccggcgggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattatagaaagccatagcattagcgcc
gggcttgattatccaggagtggggccagaacacagctatttaaaagagagcgctcgtgcg
atttatgaaagcgcaagcgattttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccagcactagaaagctcacacgccttagcgtatgccttaaaactcgct
caaaaatgcgaagaagaaagcatcatggtagtgaatttaagcggtcggggggataaggat
ttaagcaccgtttataacgctttaaaaggaggtttaaaatga

DBGET integrated database retrieval system