KEGG   Helicobacter pylori Shi470: HPSH_06625Help
Entry
HPSH_06625        CDS       T00742                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hps  Helicobacter pylori Shi470
Pathway
hps00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hps01100  Metabolic pathways
hps01110  Biosynthesis of secondary metabolites
hps01130  Biosynthesis of antibiotics
hps01230  Biosynthesis of amino acids
Module
hps_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSH_06625
Enzymes [BR:hps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPSH_06625
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HPSH_06625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACD48725
Position
complement(1303798..1305156)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSVLKKNHALPTNINPSDRDFKKALLEKKTSFILECKKASPSKGL
IRKDFDLLEIAKTYEKFASCISVLADSKYFLGSYENIKIVSQHSIKPILCKDFIIDAFQI
KLARMMGANAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIKRLLKLQYDIIGI
NNRDLHTLKTDINNTLKLRPLLPKDALVVSESGIYSHAQIKALAPYVNGFLVGSSLMKEK
DLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAV
KKLDFVGVFVKDKIKKIQKIAKKLDLKAVQLYGYSQQEIAQLKKSLPKTCAIWQVGSVMN
ANDLAPKVKEASLILYDTKGDKMGGNGVSFDWGILENVKTPFMLAGGLNLDNIQKALKVK
ALGLDFNSGLETSPGIKNKDKIKQLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaagctcctagaagtttctgtgcttaaa
aaaaatcacgctttaccgacaaacataaacccaagcgatagggattttaaaaaggcgtta
ctagaaaaaaagaccagctttattttagaatgcaaaaaagcatcgccctctaaaggttta
atcagaaaagattttgatctgttggaaatagccaagacttatgaaaaattcgcctcttgc
atttcggttttagccgattctaaatattttttaggctcttatgaaaacattaagattgtt
tcgcaacattccattaagcccattttatgcaaagattttatcattgatgcttttcaaatc
aaactcgctagaatgatgggggctaatgcggtgcttttaatgctaagcgtattagacgat
aagaattatttagagcttttcaatctcgctaaatccttaaacatgagcgtactgactgaa
gtttccaaccagcaagaaatcaagcgcttgctcaaactccaatacgacattatcggcatc
aataacagggatttacacaccttaaaaaccgacattaacaacacgctcaaattacgcccc
cttttgcctaaagacgcgctcgtggtgagtgagtccggtatttattcgcatgcgcaaatc
aaagccctagccccttatgtgaatggctttttagtgggcagctctttaatgaaagaaaag
gatttgaaaaaagcgtgtattaaattgattttaggcgaaaataaagtgtgcgggcttaca
agaattaaagacgctaaagccgtttataaaaaccattttatttatggaggtttgattttt
gaaaaatcttcgcccagatacatcaagcctaaagaagccctaaaaatcacaaaagcggtt
aaaaaattggattttgtgggcgtgtttgtgaaagataagattaaaaaaattcaaaaaatc
gctaaaaagcttgatttaaaagcggtgcagctttatggctattcgcaacaagaaatcgct
caattaaaaaaatcgctccctaaaacttgcgcgatttggcaagtagggagtgtgatgaac
gctaacgatttagcgcctaaagttaaagaagcttctctaatcctatacgacactaagggg
gataaaatgggaggcaatggcgtgagttttgattggggtattttagaaaatgtcaaaacg
cctttcatgttagctggcgggcttaatttggataatattcaaaaagccttgaaagttaaa
gcgttgggtttggatttcaattcgggtttggaaacaagccccgggattaaaaataaggat
aaaatcaagcaattagcccgaattttaagagagtattaa

DBGET integrated database retrieval system