KEGG   Helicobacter pylori Shi470: HPSH_07385Help
Entry
HPSH_07385        CDS       T00742                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hps  Helicobacter pylori Shi470
Pathway
hps00900  Terpenoid backbone biosynthesis
hps01100  Metabolic pathways
hps01110  Biosynthesis of secondary metabolites
hps01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPSH_07385
Enzymes [BR:hps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPSH_07385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACD48870
Position
1434627..1435430
Genome map
AA seq 267 aa AA seqDB search
MHAFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKFKDIISVKSALSFSLKGDFDCPLE
ENSLFKALQILKNFLKSKNFSHSAIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
QIFDWRLSLEELYSMGSLVGADTNFFISQHKSANATSYGEVIENFEEEPLENRLEIYAPN
HVFCSTKAIYQAYKPETCFSQAKEWLKKPSLECLKTCDRNGLNDLLKPALLTNQALRGIE
SELGKEWFFSGSGSAFFRLKPALKGGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcctttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaagaa
ggggcttatcataagctcatttctcgcatgtgtttggtcaaagataaattcaaagatatt
atcagcgtcaaaagcgcgctttccttttcgctaaaaggggattttgactgccctttagaa
gaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaatcaaaaaatttc
tctcattctgccatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccgggttaggcggtgggagcgctgatgctggggggctattgtatcatttgaat
caaatttttgactggcgtttgagtttagaagagctttatagcatgggatctttagtgggc
gcagacaccaactttttcatctcgcaacacaaaagcgctaacgccacttcttatggcgaa
gttattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatgcaccaaac
catgttttttgcagcaccaaagccatttatcaagcttataagcctgaaacttgtttttct
caagctaaagagtggcttaaaaaaccgagtttagaatgcctaaagacttgcgacagaaac
ggattaaacgatcttttaaagccggctttactcactaaccaagccttaagaggtatagaa
agcgaactgggtaaggagtggttttttagcgggagcgggagcgcgttttttaggctaaag
cctgcgttaaaagggggcgaatga

DBGET integrated database retrieval system