KEGG   Helicobacter pylori Sat464: HPSAT_00460Help
Entry
HPSAT_00460       CDS       T01897                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00260  Glycine, serine and threonine metabolism
hpt00750  Vitamin B6 metabolism
hpt01100  Metabolic pathways
hpt01110  Biosynthesis of secondary metabolites
hpt01120  Microbial metabolism in diverse environments
hpt01230  Biosynthesis of amino acids
Module
hpt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSAT_00460
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPSAT_00460
Enzymes [BR:hpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPSAT_00460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ADO04846
Position
complement(87451..88911)
Genome map
AA seq 486 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFETLEWQDCLNLSYNKLVECVFERL
GLEIPNGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNSTLKARQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTHSPAMDILKSSNVERALFDLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTHEKTLVSATASYEKFP
STTLLALNEQKKNDNDKTALETLKNSYNTPDSQHLDDLFERGIKHQEVLKLNEIKSSILL
WLENTH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgttctttgaaagaaaaaaagattgattttattgaagcaata
ttaaaccccaacgctccaaaaggcgggctttacactttagagcattttgaaacattagaa
tggcaggattgtttgaatctgagctataacaagctggtagaatgcgtgtttgagcggttg
ggattggagattcctaatggtttattaacaagtgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcactcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttacagcctttagcgagcttgttt
tctaatctagcggtaggaaaaaatgaaaaatatttaatgctcgtttctaccagtggcgat
accggccctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttggtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcacaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacagcactttaaaagcacgccaattaaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaatgcattaggggcgttttatgccaaaaaaatgggcttgaatatt
gctaaaatcaaggttgtaaccaacagcaatgatgttttaagggagtttatagaaacaggg
cgttacgatttaacccatcgttctttaaagcaaactcactcgccggctatggatatttta
aaaagctctaatgtggaaagagcgctttttgacctctttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaagttttatgcattaaaacctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagcttgtttgaaaacaatccaa
gaagtttatgcagagcaccaatacctgattgaccctcacaccgccaccgctttaaacgcc
agcttgaaaactcatgaaaaaacccttgtttctgccaccgcctcttatgaaaaattcccc
agcaccacccttttagccctaaacgagcaaaagaaaaacgataacgacaaaaccgcccta
gaaacgcttaaaaacagctacaataccccagacagccagcaccttgatgatttatttgaa
agaggaatcaagcaccaagaggttttaaaactcaatgagatcaaatcttctatccttttg
tggctagaaaacacgcattaa

DBGET integrated database retrieval system