KEGG   Helicobacter pylori Sat464: HPSAT_00460Help
Entry
HPSAT_00460       CDS       T01897                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hpt  Helicobacter pylori Sat464
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPSAT_00460
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSAT_00460
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPSAT_00460
Enzymes [BR:hpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPSAT_00460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(87451..88911)
Genome map
AA seq 486 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFETLEWQDCLNLSYNKLVECVFERL
GLEIPNGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNSTLKARQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTHSPAMDILKSSNVERALFDLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTHEKTLVSATASYEKFP
STTLLALNEQKKNDNDKTALETLKNSYNTPDSQHLDDLFERGIKHQEVLKLNEIKSSILL
WLENTH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgttctttgaaagaaaaaaagattgattttattgaagcaata
ttaaaccccaacgctccaaaaggcgggctttacactttagagcattttgaaacattagaa
tggcaggattgtttgaatctgagctataacaagctggtagaatgcgtgtttgagcggttg
ggattggagattcctaatggtttattaacaagtgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcactcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttacagcctttagcgagcttgttt
tctaatctagcggtaggaaaaaatgaaaaatatttaatgctcgtttctaccagtggcgat
accggccctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttggtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcacaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacagcactttaaaagcacgccaattaaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaatgcattaggggcgttttatgccaaaaaaatgggcttgaatatt
gctaaaatcaaggttgtaaccaacagcaatgatgttttaagggagtttatagaaacaggg
cgttacgatttaacccatcgttctttaaagcaaactcactcgccggctatggatatttta
aaaagctctaatgtggaaagagcgctttttgacctctttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaagttttatgcattaaaacctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagcttgtttgaaaacaatccaa
gaagtttatgcagagcaccaatacctgattgaccctcacaccgccaccgctttaaacgcc
agcttgaaaactcatgaaaaaacccttgtttctgccaccgcctcttatgaaaaattcccc
agcaccacccttttagccctaaacgagcaaaagaaaaacgataacgacaaaaccgcccta
gaaacgcttaaaaacagctacaataccccagacagccagcaccttgatgatttatttgaa
agaggaatcaagcaccaagaggttttaaaactcaatgagatcaaatcttctatccttttg
tggctagaaaacacgcattaa

DBGET integrated database retrieval system