KEGG   Helicobacter pylori Sat464: HPSAT_01070Help
Entry
HPSAT_01070       CDS       T01897                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hpt  Helicobacter pylori Sat464
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hpt00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
206945..208045
Genome map
AA seq 366 aa AA seqDB search
MVVLGSTGSIGKNALRIAKKFKVGIEALSCGKNIALINEQIKVFKPKKVAILDPNDLNGL
EPLGAKVFVGLEGIDAMIEECVSNLVINAIVGVAGLRASFKSLQTNKKLALANKESLVSA
GHLLDISQITPIDSEHFGLWALLQNKALKPKSLIISASGGAFRDTPLELIPIQNAQNALK
HPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVHALVEFEDNSIIA
HLARADMQLPISYAINPKLASLSASIKPLDLYALSAIKFEPISMERYTLWRYKDLLLENP
KLGVVLNASNEVAMEKFLNQEIAFGGLIKTISQALESYAKTPFKLSDLDEVLALDREVRE
RFKNYS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttaggaagcaccggctctattgggaaaaacgccctaagaatcgcaaaaaaa
ttcaaggtaggaatagaagccttaagctgtgggaaaaatatcgctttaatcaatgagcaa
atcaaagttttcaaacccaagaaagtggcgatcttagatcctaacgatttgaatggttta
gagcctttgggcgcgaaagtgtttgtagggctagagggcattgatgcgatgatagaagag
tgcgtttcaaatttagtcattaacgccattgtgggcgtggctggattgagggcgagcttt
aaaagcttgcaaactaacaaaaaactagccctagcgaataaagaaagcttggtgagcgcg
gggcatttattagacatttcacaaatcacgcccattgatagcgagcattttgggttgtgg
gcgttgttgcaaaacaaggctttaaagcctaaatccttaatcattagtgcgagtgggggg
gctttcagggacacgcctttagaactcattcctattcaaaacgcgcaaaacgcgctcaag
caccctaattggagcatgggatctaaaatcactattgattcagcgagcatggtcaataag
ctttttgaaatcctagaaacctattggctttttggcgcgtctttaaagattgatgcgctg
attgaaaggagttctatcgtgcatgctttggtggagtttgaagataactctatcattgcg
catttggcaagagcggacatgcaattgcccataagctatgccattaaccctaaattagcc
tctttgagcgcgtctatcaaacccttagatctatacgctttaagtgcgattaaatttgaa
cccattagcatggagcgctacactttgtggcgttataaagacttgttgttggaaaaccca
aagcttggcgtggtgctgaatgcgagcaatgaggtggcgatggagaagtttttaaatcaa
gagatcgcttttggtgggcttatcaaaaccatttctcaagccctagaatcatacgctaaa
acgcctttcaagctctctgatttagatgaagtgctggcgttggatagggaagttagggag
cgttttaaaaattacagctag

DBGET integrated database retrieval system