KEGG   Helicobacter pylori Sat464: HPSAT_02060Help
Entry
HPSAT_02060       CDS       T01897                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hpt  Helicobacter pylori Sat464
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hpt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
403707..404198
Genome map
AA seq 163 aa AA seqDB search
MMREILTSRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKILSSP
VYINPPFGYTKQPNFYNATIILKTSLSLRHFFALVFYIERRFGRQRKRDFKDAPRTLDID
IIVFNQVILRQNDLTLPHPKWSERDSVLVPLALQQILFKKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatccttactagccgctttttccctagcctttttaaaaaaaggcttgat
ttttctaacagggtggttttagggctaggatctaatcttaaaaatcctttgaaaatatta
aaaaattgttttttatattttaaaaatcatagtaaaatcgggaaaattctttcttcgcct
gtttatatcaacccgccttttggttacacgaagcaacctaacttttataacgctacgatt
atccttaaaacatctttaagtttgcgccattttttcgctctggttttttatatagaaagg
cgttttgggcgccaaaggaagcgcgattttaaagacgctccaagaactttagacattgat
attatcgttttcaatcaagtcattttaagacagaatgatttgactttacctcatcctaaa
tggagtgaaagggattcggtgttagtgccgttggctttgcaacaaattctttttaaaaaa
ggggagtggtga

DBGET integrated database retrieval system