KEGG   Helicobacter pylori Sat464: HPSAT_02285Help
Entry
HPSAT_02285       CDS       T01897                                 

Definition
(GenBank) type II R-M system methyltransferase
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TaqI_C N6_Mtase UPF0020 MTS Methyltransf_31 HTH_17 Methyltransf_15 Cons_hypoth95 HTH_23 UPF0122 Methyltransf_11 Methyltransf_12 HTH_38 Terminase_5 PrmA
Motif
Other DBs
NCBI-ProteinID: ADO05204
Position
449563..451200
Genome map
AA seq 545 aa AA seqDB search
MPSNALCIEEIARLINVSHSSVHNWIKTNLLEKLEIDHKIYVKTSSFLDFCRNHLGKNKL
NKYANKSLKGTHNHQELILKYLKILENSSDLEKLGSYYEEELSNTTRNLEGIYYTPNRIV
EQLFTLPKDFDASQAIFCDPAVGSGNFIMHALKLGFKVENIYGYDTDAFAIALTKKRIKE
RYHLDCPNIVQKDFLNLKHTPQFDCIFTNPPWGKKYNQNQKEIFKQRFNLSQSLDSASLF
FIASLNCLKENAHLGLLLPESCLNIDAFSKMREMALKFQIRSLIDFNKPFKTLMTKAVGL
ALKKAPNKDQKISCFYQNSEFKRSPSSFLNNPKKIFNIHCSSKENKILDHLFSFSHITLK
NNAHFALGIVTGNNKEKLHSKQEKNTIPIFRGSDILKDRLKAPSQFINADLKDCQQVAPL
SLYQSREKIVYKFISSKLVFFYDNKQRLFLNSANMFVLKENFPINANALKELLNSDLMQF
IFESLFKTHKILRKDLECLPLFAQFINNSFDEKFYLKNLGIEKKDPKHFTIRKNHAHCLS
FGFRG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaaacgctctttgtattgaagaaatcgctcgcctaatcaatgtttctcatagc
agcgtgcataactggatcaaaaccaatcttttagagaaactagagattgatcacaaaatt
tatgtgaaaacaagctcttttttagatttttgccgcaaccatttagggaaaaacaagctc
aacaaatacgctaacaaatccttaaaaggcacacataaccatcaagaattgattttaaaa
tacctaaaaatattagaaaatagctctgatttagaaaagttgggttcttattatgaagaa
gagctttctaacaccaccagaaatttagaaggcatttactacactcctaataggatagtg
gaacagcttttcactctccctaaagattttgatgcctctcaagcgattttttgcgatccg
gctgtggggagcgggaatttcatcatgcatgctttaaagttgggttttaaggttgaaaat
atttatggctatgatacggacgctttcgctatcgctttgactaaaaagcgtattaaagag
cgttatcatttggattgccctaatattgtgcaaaaagattttttaaatttaaaacacacc
ccacaatttgattgcattttcactaacccgccatggggcaagaaatacaatcaaaaccaa
aaagaaattttcaaacagcgctttaatctctctcaaagcctagatagcgcgtcgctcttt
tttatagcgagtttgaattgtttaaaagaaaacgctcatttggggctattattacccgaa
agttgtttgaatattgatgcgtttagcaaaatgcgagaaatggctctgaagtttcaaatt
agaagccttattgattttaacaaaccctttaaaaccctaatgactaaggctgtgggtttg
gcgcttaaaaaagcccctaacaaggatcaaaaaatctcatgcttttatcaaaatagtgag
ttcaaacgctcgccctcttcttttttaaacaaccctaaaaagatttttaatatccattgc
tctagcaaagaaaataaaattttagaccaccttttttccttttctcatataactttaaaa
aataacgctcattttgctttagggattgttacaggcaacaataaagaaaaattacactcc
aaacaagaaaaaaataccattcctatttttaggggttcagatattttaaaagacagatta
aaagcccctagccaattcattaacgctgatttaaaagactgccagcaagtcgctccctta
agcctttatcagtctagggaaaaaatcgtgtataaattcatttcttcaaagcttgtcttt
ttttatgataataagcaacgcctttttttaaatagcgcgaacatgtttgttttaaaagaa
aattttcctatcaacgctaatgcgctaaaggaattattaaacagcgatttaatgcaattt
atttttgaatctctttttaaaacgcataaaattttaagaaaagatttggaatgtttaccc
ctatttgcacaatttatcaacaatagttttgatgaaaaattttatttgaaaaatttaggg
atagaaaaaaaagaccctaaacattttacaatcaggaaaaaccatgcacattgcttgtct
tttggctttaggggataa

DBGET integrated database retrieval system