KEGG   Helicobacter pylori Sat464: HPSAT_02310Help
Entry
HPSAT_02310       CDS       T01897                                 

Definition
(GenBank) type II DNA modification enzyme (methyltransferase)
  KO
K00558  
DNA (cytosine-5)-methyltransferase 1 [EC:2.1.1.37]
Organism
hpt  Helicobacter pylori Sat464
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HPSAT_02310
Enzymes [BR:hpt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     HPSAT_02310
DNA replication proteins [BR:hpt03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    HPSAT_02310
Chromosome [BR:hpt03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    HPSAT_02310
Prokaryotic defense system [BR:hpt02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    HPSAT_02310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
455520..456566
Genome map
AA seq 348 aa AA seqDB search
MYKVADIFCGAGGLSYGFSMHPYFELIWANDIDKDAILSYQVNHKEVQTILCDIMQLNCH
NLPCVSIDILLGGPPCQSYSTLGKRKMDEKANLFKEYLRLLDLVKPKMFVFENVVGLMSM
QKGQLFKQICNAFKERGYVLEHAILNALDYGVPQIRERVILVGVLKSFKQKFHFPKPIKT
HFSLKDALGDLPPIQSGENGDALGYLKNADNVFLEFVRNSKELSEHSSPKNNEKLIKIMQ
TLKDGQSKDDLPKNLRPKSGYTNTYAKMWWEKPAPTITRNFSTPSSSRCIHPRDSRALSV
REGARLQSFPDNYKFCGSTSAKRLQIGNAVPPLLSVALAHAVFDFLKG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ttgtataaggtagcagatattttttgtggtgctggaggattgagctatggcttttctatg
cacccttattttgaattgatatgggctaacgatatagacaaggacgctattttaagctat
caagttaatcataaagaggtgcaaaccattttatgtgatattatgcagcttaattgccac
aacttaccatgcgtttcaattgatattctactaggcggaccaccatgccagagctattct
acccttggcaaaagaaaaatggatgaaaaagcgaatctgtttaaagaatatttgcggctc
ttagatttagtaaaaccaaaaatgtttgtttttgaaaatgtggtgggtttaatgtctatg
caaaaagggcaattattcaaacaaatttgtaacgcttttaaagagagaggttatgtttta
gagcatgccattttaaacgccctagattatggtgtgcctcaaataagagagcgagtgatt
ttagtgggtgtgcttaaaagttttaaacaaaaattccacttccccaaacccataaaaacg
catttttctctaaaagacgctttaggggatttaccacctattcaaagcggtgaaaatggt
gatgctttaggttatcttaaaaatgcggataatgtttttttggaatttgtgcgaaattct
aaagaattaagcgagcatagcagtcctaaaaataatgagaaacttataaaaatcatgcaa
acgctaaaagacggacagagtaaagatgatttgcccaaaaatttacgccccaaaagtggt
tatactaatacctatgccaaaatgtggtgggaaaaaccagcccccaccattacaagaaat
ttttctaccccaagcagttctaggtgtatccatccaagagactctagagcgttaagcgtt
agagagggagcaagattgcaaagttttcctgataattataaattctgtgggagcactagt
gctaaaagattgcaaattggcaatgccgtgccgcctttattgagtgtagcgctcgctcat
gcggtttttgattttttaaaggggtaa

DBGET integrated database retrieval system