KEGG   Helicobacter pylori Sat464: HPSAT_02315Help
Entry
HPSAT_02315       CDS       T01897                                 

Definition
(GenBank) hypothetical protein
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADO05210
Position
456569..457309
Genome map
AA seq 246 aa AA seqDB search
MFDNNDFKGYRNLLGFNSQNTFKEFLGAKDIQPCVDFNYLNALKKRLIEIFSAINSVYCF
KYNEYELECFFKNSIERVFSKLVDTHIIYKLNNQGRRPEEVCFSWMRGFLVAEFFKGFIA
CLFGAQKETIKFFGGDNFESIESFKRSPKADFLLDNHLLLEVQSGFQGINDIKEHKVIEA
KRRLITDKIPTIVVHFDLFNGQVACVEISKIKDNDLNWITRQQMEGQSVFNISQNFFDHK
ITEIPK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataataacgattttaaaggttatagaaatttattgggttttaattctcaaaat
acatttaaggaatttttaggcgctaaagacatacaaccttgcgttgatttcaattattta
aacgcgctcaaaaaaaggcttattgaaatttttagcgctatcaatagtgtttattgtttt
aaatataatgagtatgaattggaatgcttttttaaaaactccatagagcgagtgttttca
aagctagtggatactcatattatttataagctgaataatcaaggcagaaggcctgaagaa
gtgtgtttttcttggatgcgtgggtttttagtagcggagttttttaagggttttatcgct
tgtctttttggcgcacaaaaagaaaccatcaaattttttggtggggataattttgaaagc
atagaaagctttaaaagaagtcctaaagccgattttttgttagacaatcatttattacta
gaagttcaaagcgggtttcaagggatcaatgatattaaagaacataaagttatagaagct
aaaaggcgtttgataacggataaaattcctactattgtggtgcattttgatctgtttaac
gggcaagtagcgtgcgtggaaatttctaaaatcaaagacaatgatttgaattggataacc
cgccaacaaatggaagggcagagcgtttttaatatttcgcaaaacttttttgatcacaaa
attacagaaatacctaaataa

DBGET integrated database retrieval system