KEGG   Helicobacter pylori Sat464: HPSAT_02345Help
Entry
HPSAT_02345       CDS       T01897                                 

Gene name
ruvC
Definition
(GenBank) Holliday junction resolvase
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HPSAT_02345 (ruvC)
Enzymes [BR:hpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     HPSAT_02345 (ruvC)
DNA repair and recombination proteins [BR:hpt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     HPSAT_02345 (ruvC)
    RecFOR pathway proteins
     HPSAT_02345 (ruvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvC Tex_YqgF RuvX
Motif
Other DBs
NCBI-ProteinID: ADO05216
Position
464272..464745
Genome map
AA seq 157 aa AA seqDB search
MRILGIDPGSRKCGYAIVSHTSNKLSLITAGFINITTTRLQEQILDLIEALDCLLDRYEV
NEVAIEDIFFGYNPKSVIKLAQFRGALSLKILERIGNFSEYTPLQVKKALTGNGKAAKEQ
VAFMVKRLLNITSEIKPLDISDAIAVAITHAQRLKPH
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattttaggaatagatccgggcagtaggaaatgcgggtatgctatcgtttctcac
acttctaacaagctttctttaatcacagccggattcattaacatcaccacgacacgcttg
caagaacagattttagacttgatagaagccttagattgcttattggatcgttacgaagtt
aatgaagtagcgattgaagatattttctttgggtataatcctaaaagcgtgatcaagctt
gcgcaattcaggggggcgttgtccttaaagattttagaaaggatcggtaattttagcgaa
tacacgcccttacaagtcaaaaaagccctaaccggtaacgggaaagccgctaaagagcaa
gtagcctttatggtcaaacgcttgcttaacatcacaagcgaaatcaagcctttggatatt
agcgatgcgatagccgttgctatcacgcatgcgcaacgcttaaaaccccactaa

DBGET integrated database retrieval system