KEGG   Helicobacter pylori Sat464: HPSAT_02355Help
Entry
HPSAT_02355       CDS       T01897                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00380  Tryptophan metabolism
hpt00630  Glyoxylate and dicarboxylate metabolism
hpt01110  Biosynthesis of secondary metabolites
hpt01130  Biosynthesis of antibiotics
hpt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HPSAT_02355
  Amino acid metabolism
   00380 Tryptophan metabolism
    HPSAT_02355
Enzymes [BR:hpt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     HPSAT_02355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-ProteinID: ADO05218
Structure
PDB: 

Jmol
Position
467446..468972
Genome map
AA seq 508 aa AA seqDB search
MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGS
GAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGEKGSADAVRDPRGFAMKYYTE
EGNWDLVGNNTPVFFIRDGIKFPDFIHTQKRDPQTNLPNHDMVWDFWSNVPESLYQVTWV
MSDRGIPKSFRHMDGFGSHTFSLINAKDERFWVKFHFHTMQGVKHLTNEEAAEIRKHDPD
SNQRDLFNAIARGDFPKWKLSIQVMPEEDAKKYRFHPFDVTKIWYLKDYPLMEVGIVELN
KNPENYFAEVEQAAFSPSNVVPGIGYSPDRMLQARLFSYTDTQRYRLGVNYPQIPVNKPR
CPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDPKFNLAHIEKEFEVWNWDYRA
DDSDYYTQPGDYYRSLPADEKERLHDTIGESLAHVTHKEIVDKQLEHFKKADPKYAEGVK
KALEKHQKMMKDMHDMHGKDMHHMKKKK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggttaataaagatgtgaaacaaaccactgcttttggcgctcccgtttgggatgacaac
aatgtgattacggctggccctagaggtcctgttttattgcaaagcacttggtttttggaa
aagttagcggcgtttgacagagaaaggatccctgaaagggtggtgcatgctaaaggaagc
ggagcttatggcactttcactgtgactaaagacatcactaaatacactaaagcgaaaatt
ttctctaaagtgggcaaaaaaacagaatgctttttcagattttctactgtggcaggggaa
aaaggcagtgcggatgcggtgagagaccctagaggttttgcgatgaagtattacactgaa
gaaggtaactgggatttagtagggaacaacacgcctgttttctttatccgtgacgggatc
aaattccctgatttcatccacactcaaaaacgagatcctcaaaccaatttgcctaaccac
gacatggtatgggatttttggagtaatgttcctgaaagtttgtatcaagtaacatgggtt
atgagcgatagaggtattcctaaatctttccgccacatggatggttttggcagccacact
ttcagccttatcaacgcaaaagacgaacgcttttgggtgaagttccactttcacaccatg
caaggcgttaagcacttgactaatgaagaagctgcagaaatcagaaagcatgatcctgat
tccaatcaaagggatttattcaatgcgatcgctagaggggatttcccaaaatggaaatta
agcattcaagtgatgccagaagaagatgctaaaaagtatcgattccatccgtttgatgta
actaaaatttggtatctcaaagattatccattgatggaagtgggtattgtagagttgaat
aaaaatcctgaaaactatttcgcagaagtggagcaagcggcattctctccgtctaatgtc
gttcctggaattggctatagccctgataggatgttacaagctcgcttgttctcttataca
gacacacaacgctaccgcttaggggttaattatcctcagataccggtcaataaaccaagg
tgtccgttccactcttctagcagagatggttacatgcaaaacggatactacggctcttta
caaaactatacgcctagctcattgcctggctataaagaagataagagtgcgagagatcct
aagttcaacttagctcatattgagaaagagtttgaagtgtggaattgggattacagagct
gatgatagcgattactacacccaaccaggcgattactaccgctcattgccagctgatgaa
aaagaaaggttgcatgacactattggagagtctttagctcatgttacccataaagaaatt
gtggataaacaattggagcatttcaagaaagctgaccccaaatacgctgagggagttaaa
aaagctcttgaaaaacaccaaaaaatgatgaaagacatgcatgacatgcatggaaaagac
atgcaccacatgaaaaagaaaaagtaa

DBGET integrated database retrieval system