KEGG   Helicobacter pylori Sat464: HPSAT_02390Help
Entry
HPSAT_02390       CDS       T01897                                 

Definition
(GenBank) hypothetical protein
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMMR_N DUF354 OmpH Exonuc_VII_L
Motif
Other DBs
NCBI-ProteinID: ADO05225
Position
474552..475013
Genome map
AA seq 153 aa AA seqDB search
MQEELNAYQQEIKDTREVLKKTRLELKQVQEILRKKKSTLKGLKQEIYQKKLEKENSRLN
KETQNTQEDVIFPKALEEVEIYTNDNQVIIAKPSKRVFDEGLYLQYRSVLRENRLLKNHL
SKKDFENSLLKIELRDLHKEIKLYQVQNLLKDK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagaattgaacgcttaccaacaagaaattaaagacactagagaagttttaaaa
aaaacccgtttggaattgaagcaagtccaagaaatcttgcgtaagaaaaagagcacctta
aaaggtttgaagcaagaaatctatcaaaaaaaattagaaaaagaaaactcccgcttaaac
aaagaaacacaaaatacacaagaggatgtaattttccctaaagcccttgaagaagtggag
atttacactaatgataatcaagttataatagcaaaacccagcaagcgcgtgtttgatgaa
gggctttatttgcaataccgtagcgttttgcgcgaaaacaggcttttaaaaaaccatctc
tctaaaaaagattttgaaaattcgttactcaaaattgaattaagggatttgcataaagaa
atcaaactctatcaagtccaaaaccttttgaaagacaaataa

DBGET integrated database retrieval system