KEGG   Helicobacter pylori Sat464: HPSAT_02405Help
Entry
HPSAT_02405       CDS       T01897                                 

Gene name
dut
Definition
(GenBank) deoxyuridine 5'-triphosphate nucleotidohydrolase
  KO
K01520  dUTP pyrophosphatase [EC:3.6.1.23]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00240  Pyrimidine metabolism
hpt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HPSAT_02405 (dut)
Enzymes [BR:hpt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     HPSAT_02405 (dut)
DNA repair and recombination proteins [BR:hpt03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    HPSAT_02405 (dut)
 Prokaryotic Type
    HPSAT_02405 (dut)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dUTPase FTR
Motif
Other DBs
NCBI-ProteinID: ADO05228
Position
476620..477057
Genome map
AA seq 145 aa AA seqDB search
MKIKIQKIHPNALIPKYQTEGSSGFDLHAIEEVMIKPHSVGLVKIGICLSLEVGYELQVR
TRSGLALNHQVVVLNSPGTVDNDYRGEIKVILANLSDKDFKVQVGDRIAQGVVQKTYKAE
FIECEQLDETSRGSGGFGSTGVSKA
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaatccaaaaaatccacccaaacgcccttatccctaaataccaaaccgag
ggttcttcaggctttgatttgcatgctatagaagaagtaatgatcaaacctcatagcgtg
ggcttggtgaaaatagggatttgtttgtctttagaagtggggtatgaattgcaagtgcgc
acccgtagcggtttggctttgaatcatcaggtggtagtgttaaattctcctggcacggtg
gataatgattataggggcgaaattaaggtcattttagcgaatttgagcgataaagatttt
aaggttcaagtaggggataggatcgctcaaggggtggttcaaaaaacttataaagccgaa
tttatagaatgcgaacaattagatgaaacttcaaggggtagcgggggctttggcagcaca
ggagtgagtaaggcatga

DBGET integrated database retrieval system