KEGG   Helicobacter pylori Sat464: HPSAT_02415Help
Entry
HPSAT_02415       CDS       T01897                                 

Definition
(GenBank) hypothetical protein
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGBA_C ANAPC4_WD40
Motif
Other DBs
NCBI-ProteinID: ADO05230
Position
477715..479427
Genome map
AA seq 570 aa AA seqDB search
MNKPFLILLIALIVFSGCNMRKYFKPAKHQIKGEAYFPNHLQESIVSSNRYGAILKNGAV
IGDKGLTQLRIGKNFNYESSFLNESQGFFILAQDCLNKIDKKTSKSKVAKTEETELKLKG
VEAEVQDKVCHQVELISSNPNASQKSIIIPLETFALSASVKGNLLAVVLADNSANLYDIT
SQKLLFSEKGSPSTTINSLMAMPIFMDTVVVFPMLDGRLLVVDYVHGNPTPIRNIVISSD
KFFNNITYLIVDGNNMIASTGKRILSVVSGQEFNYDGDIVDLLYDKGTLYVLTLDGQILQ
MDKSLRELNSVKLPFASLNTIVLNHNKLYSLEKRGYVIEVDLNDFNSYNVYKTPTIGSFK
FFSSNRLDKGVFYDKNRVYYDRYYLDYNNFKPKLYPVVEKPASEKSQKGEKRNAPIYLQE
RHKAKEKPLEENKVKPRNSGFEEDEVKARRRDMEPINNQNNANNENKVGNENKVGNENNA
IQRGENKNAPVSKENNQKGTENAPVLKEDNAFKEAPKLSPKEEKRRLKEEKKKAKAEQRA
REFEQRAREQQERDEKELEERKKALEMNKK
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaccatttttaatcttactcatagccctaattgtttttagcggctgtaacatg
agaaaatacttcaaacccgctaaacaccaaattaaaggcgaagcgtatttccctaaccat
ttgcaagaaagcatcgtttcgtctaatcgttatggagccattttgaaaaatggagcggtt
ataggcgataagggtttaacgcagctaagaatcggtaagaatttcaattatgaaagcagt
tttttaaatgagagtcaggggtttttcatccttgcgcaagattgtttgaacaagattgat
aaaaaaacaagcaaaagcaaggtggctaagactgaagaaacggaattgaaattaaagggc
gttgaagcagaagtccaagataaagtctgccatcaagtggaattgattagctctaaccct
aacgccagccagaaatccatcattattcctttggagacttttgccttgagcgcgagcgtt
aaagggaatcttttagcggtggtgttagcggacaattcagcgaatttatacgacatcact
tctcaaaaattgctttttagtgagaaaggttccccaagcaccacgatcaattctttgatg
gcgatgcctatttttatggatacggtcgtggtattccccatgctagatgggcgtttgtta
gtcgtggattatgtgcatggaaaccctacgcctattagaaacattgttatcagcagcgat
aagttttttaacaatatcacttaccttatcgtagatggcaataacatgatcgcttctaca
gggaaaagaatactctcagtagtgagcggtcaagagttcaactatgatggggatattgtg
gatttgctttatgataaggggactttatatgtgctcacgctagacgggcagattttgcaa
atggataagagtttgagagaattaaacagcgtgaaactgccctttgcttcgctcaatacc
attgtattaaaccataataaattgtattctttagaaaaacgagggtatgtgatagaggtg
gatttgaatgattttaattcgtataatgtctataaaacgccaactataggcagttttaag
tttttttcatccaatcgtttggataaaggggtgttttatgataaaaatcgggtgtattat
gatcgctactatttagattataataattttaaacccaagctttatcccgttgtggaaaaa
cctgcatctgaaaaatctcaaaaaggcgaaaaaaggaacgctcctatttatttgcaagaa
aggcataaagctaaagaaaagcctttagaagaaaacaaagttaagccaagaaatagcggg
tttgaagaggatgaagttaaagccagaaggcgcgatatggagcctattaacaaccaaaat
aatgctaacaacgaaaataaagtaggcaacgaaaataaagtaggcaacgaaaataacgct
atccaacgaggcgaaaacaaaaacgctcctgtttcaaaagagaataaccaaaaaggcaca
gaaaacgctcctgtcttaaaagaggataacgcttttaaagaagcgccaaaactcagccct
aaagaagaaaaacgccgcttgaaagaagaaaagaaaaaagccaaagccgaacaaagggcg
agagaatttgaacaaagagcgagagagcaacaagaaagagatgaaaaagagcttgaagaa
agaaaaaaagctttagaaatgaataagaagtag

DBGET integrated database retrieval system