KEGG   Helicobacter pylori Sat464: HPSAT_02495Help
Entry
HPSAT_02495       CDS       T01897                                 

Definition
(GenBank) hydroxyethylthiazole kinase
  KO
K00878  hydroxyethylthiazole kinase [EC:2.7.1.50]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00730  Thiamine metabolism
hpt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    HPSAT_02495
Enzymes [BR:hpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.50  hydroxyethylthiazole kinase
     HPSAT_02495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HK Carb_kinase Phos_pyr_kin DUF2190
Motif
Other DBs
NCBI-ProteinID: ADO05246
Position
497167..497946
Genome map
AA seq 259 aa AA seqDB search
MLKELRQKRPLVHNITNYVVAQFVANGLLALGTSPLMSDAIAEMQDLAKISDALAINIGT
LNERTILCAKEAIKHYKALNKPIVLDPVGCSASALRHGTSLELLESEGISVLRGNAAELG
SLVGISCKSKGLDSHYATTPIEIVKLAAQKYSVIAVMTGKTDYVSDGKKVFSITGGSEYL
ALITGAGCLHTAACASFLSLKKDPLDSMAQLCALYKQAAFNAQKKVLENNGSNGSFLFYF
LDALSLPIKLENSLIKEEL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagaattacgccaaaaacgccccttagtgcataatatcaccaattatgtggtg
gcgcaatttgtggctaatggtttattagccttagggacatcgcctttaatgagtgatgcc
attgctgaaatgcaagatttagcaaaaatttctgacgcgctcgctatcaatattggcact
ctcaatgaacgcaccattttatgcgctaaagaggctatcaaacattataaggctttgaat
aaacccattgtgttagatcctgtggggtgttcagcgagcgctttacgccatggcacaagt
ttagagcttttagaaagcgaagggattagcgttcttaggggtaatgctgcagaattaggc
tctttagtggggatttcgtgcaaaagtaaggggctagactctcattatgccaccacgcct
atagaaatagtcaaactagcggctcaaaaatattctgtgatagcggtaatgacgggtaaa
acagattatgtgagcgatgggaaaaaagtttttagtattactggggggagcgagtattta
gcgctcattactggggctgggtgtttgcacacagcggcgtgtgcgagctttttaagtttg
aaaaaagaccccctagattctatggcgcaactttgcgcgctctataaacaagccgctttt
aatgcgcaaaaaaaggtgttagaaaataacggctctaatggttcattcttgttttatttt
ttagacgctctaagcttgcccataaagctagaaaatagccttattaaggaagagttgtga

DBGET integrated database retrieval system