KEGG   Helicobacter pylori Sat464: HPSAT_02545Help
Entry
HPSAT_02545       CDS       T01897                                 

Definition
(GenBank) putative bifunctional alpha-2,3/-2,8-sialyltransferase
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
506169..507278
Genome map
AA seq 369 aa AA seqDB search
MNKKPLIIAGNGPSIKDLDYSLFPKDFEVFRCNQFYFEDKYYLGREIKGVFFNAHVFDLQ
MKITQAMIKGSEYHLEHIYCTHAEPYFYINDRQQLVQEYLEKHFVGVRSTYAYLKGLEPF
FILHSKYRNFYNQHFTTGIMMLLVAIALGYKEIYLCGIDFYENGFEHFYENQGDFFEEGP
DPMHDKSIDTQALELAKKHAKIYALAPNSSLAKWLPLSPQKGVLEKVRERICLGNFKREN
FGQKELERQKELERQKELERQKELERQKELERQKELERQKELERQKELERQKELERQKEL
ERQKELERQKELERSLKARLKVVLASKGIKSDNLIIISLKDAYRLFKGGLALLLDLKALK
SIIKAFLKR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaacccctaatcattgccggcaatggccctagcatcaaggatttggattac
tctctgttccccaaagattttgaagtctttaggtgcaaccagttctattttgaagacaag
tattatttagggagggaaattaagggggtgttttttaacgcccatgtgtttgatttgcaa
atgaaaatcactcaagcgatgatcaagggctctgaataccatttagagcatatttattgc
acgcatgcagaaccctatttttacataaacgatcgccaacaattggtgcaagaatatttg
gaaaagcattttgttggggttcgctccacttatgcatatttaaagggtttagagcctttt
tttattttgcattcaaaataccgcaatttttataatcagcacttcactacggggattatg
atgctgcttgtagcgatcgccttgggttataaagagatctatttgtgcgggattgatttt
tatgaaaacggctttgagcatttctatgaaaatcaaggagacttttttgaagaaggtccc
gatcccatgcatgataaaagtattgacacccaagctcttgaattagccaagaaacacgcc
aaaatctacgctctagcgcctaatagctcgttagcaaaatggttgcctttatccccacaa
aaaggggttttagagaaagtcagagagcgtatttgcttaggaaattttaagcgtgaaaat
tttgggcaaaaagaattagaaagacaaaaagaattagaaagacaaaaagaattagaaaga
caaaaagaattagaaagacaaaaagaattagaaagacaaaaagaattagaaagacaaaaa
gaattagaaagacaaaaagaattagaaagacaaaaagaattagaaagacaaaaagaatta
gaaagacaaaaagaattagaaagacaaaaagaattagaaagaagcttaaaggcaaggtta
aaagttgttttagccagcaaagggattaagagcgataatcttattatcatcagtttgaaa
gacgcttaccgcctttttaagggaggccttgctcttttattggatttaaaagcgctcaaa
tccatcataaaggcatttttaaaacgctaa

DBGET integrated database retrieval system